KEGG   Rattus norvegicus (rat): 679975Help
Entry
679975            CDS       T01003                                 

Gene name
Gpr183, Ebi2
Definition
(RefSeq) G protein-coupled receptor 183
  KO
K04305  Epstein-Barr virus induced gene 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    679975 (Gpr183)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Oxysterol
    679975 (Gpr183)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 679975
NCBI-ProteinID: NP_001102856
RGD: 1598095
Ensembl: ENSRNOG00000025094
UniProt: D4A7K7
Position
15q25
AA seq 357 aa AA seqDB search
MANNFTTPLAASHGNNCDLYAHHSTARILMPLHYSLVFIIGLVGNLLALVVIVQNRKKIN
STTLYSMNLVISDILFTTALPTRIVYYALGFDWRIGDALCRITALLFYINTYAGVNFMTC
LSIDRFFAVVHPLRYNKIKRIEYAKGICVFVWILVFAQTLPLLLKPMSKQEADKTTCMEY
PNFEGTASLPWILLGACLLGYVLPLAIILLCYSQICCKLFRTAKQNPLTEKSGVNKKALN
TIILIIGVFVLCFTPYHVAIMQHMVKTLYAPGALGCGVRHSFQISLHFTVCLMNFNCCMD
PFIYFFACKGYKRKVMKMLKRQVSVSISSAVRSAPEENSREMTESQMMIHSKASNGR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaattttactacaccactggcagcttctcacggcaataactgtgatctctat
gcacaccacagcacggccaggatattaatgcctctgcattatagcctggtcttcatcatt
ggtctggtgggaaacttgttggccttagttgtcattgttcaaaatagaaaaaaaatcaac
tcaaccactctctattcaatgaacttggtgatttccgacatcctgtttaccacagcttta
cctacgcggatagtctactatgccctgggttttgactggaggattggtgatgccctgtgc
cggataactgctctgttgttctacatcaacacgtatgcaggtgtgaacttcatgacttgt
ttgagcatagaccgattctttgccgtggtgcaccctctgcgctacaacaagattaaaaga
attgaatatgcaaagggcatttgtgtatttgtctggattttggtgtttgctcaaacactg
ccactgctcctcaaacccatgtctaagcaggaggcagacaagactacttgcatggaatat
ccaaattttgaagggacagcatctctcccgtggattctgctcggagcctgcctgctaggc
tacgtgctgcctcttgccatcattctcctgtgctactctcagatctgctgcaaactcttc
aggactgccaagcagaacccactgaccgagaaatctggtgtgaacaaaaaggctctcaac
acgatcatcctcatcatcggcgtgttcgtcttgtgcttcacgccctaccacgtggccatt
atgcagcacatggtgaagactctctacgcccccggagccctcggctgtggggtgagacac
tccttccagatctctctgcacttcacagtgtgcctgatgaacttcaactgctgcatggac
cctttcatatacttctttgcatgtaaagggtacaagagaaaggtcatgaagatgctcaaa
cgtcaagtgagcgtgtcaatctccagtgcagtgaggtcagcccctgaggagaactcacgg
gaaatgacggagtcacagatgatgatccactccaaggcctccaatgggaggtaa

DBGET integrated database retrieval system