KEGG   Rattus norvegicus (rat): 679994
Entry
679994            CDS       T01003                                 
Symbol
H3c1
Name
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    679994 (H3c1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    679994 (H3c1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    679994 (H3c1)
  09165 Substance dependence
   05034 Alcoholism
    679994 (H3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    679994 (H3c1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    679994 (H3c1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    679994 (H3c1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   679994 (H3c1)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 679994
NCBI-ProteinID: XP_017456209
RGD: 1598076
Ensembl: ENSRNOG00000046144
UniProt: Q6LED0
Position
17:41367824..41368902
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggctccgcgcaagcag
ttggccaccaaagctgcccgcaaaagcgccccggccaccggcggtgtgaagaagccccac
cgctaccgtcccggcaccgtggctctgcgcgagatccggcgctaccagaagtccaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgtgagatcgcgcaggacttcaag
accgacctgcgtttccagagctcggctgtcatggccctgcaggaggcttgtgaggcctac
cttgtgggtctgtttgaggacaccaatctgtgcgccatccacgccaagcgtgtgaccatc
atgcccaaggacatccagctggcccgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system