KEGG   Rattus norvegicus (rat): 680014
Entry
680014            CDS       T01003                                 

Gene name
Esco1
Definition
(RefSeq) establishment of sister chromatid cohesion N-acetyltransferase 1
  KO
K11268  N-acetyltransferase [EC:2.3.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680014 (Esco1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     680014 (Esco1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    680014 (Esco1)
SSDB
Motif
Pfam: Acetyltransf_13 zf-C2H2_3 DUF465
Other DBs
NCBI-GeneID: 680014
NCBI-ProteinID: NP_001119771
RGD: 1596873
Ensembl: ENSRNOG00000014031
UniProt: B2GUX2
Position
18p13
AA seq 840 aa
MSIQEKSKENSSKVIKESEGENLEQEIEGSQNSLAKKSGSKEAGKSAVRFSNKSKVNQSE
IGTRMSTRSASCSADKNATNSINKNMVSVKGQSQESLKKKKLCQEKLSFGTFKGSEQLNR
RSQRLQQLTESLTRSLRSREIQGQIQTVKQNLQPARREQCNSTQSKCNKVNQKHVKRKVL
EIKSDCKEDRHSVTNEVINSPKGKKRKVQHQTTSTCSSQCIQGSEKCLQKTIRKEETKPV
PVTAEIRKLKTATSVVSKRNELRKSAHTQVSASTKFPQIPLPLVPEHSVDHELEQPGKSK
RGSILQLCEEIAGEIESDTVEVKKESCVESVKEEKPAEVKLEETDAERQTLHQKETNQDV
QCNRFFPSRKTKPVKCVLNGINSSTKKNSNWTKIKLSKFNSVHQHKLDSQVSPKLSLLQT
FLSPPVLEMPHPVSQSTFLEMKPHGTVTCQQDKMKGIKSEDVKINNIAIEINKATKRAPG
NCNLDNHIKPSSDSSLDNQMKHSCESAPDQNFSICSASEVETNPLENTAAVSTLLSQARI
DGDRKFPGSAPNQQHSILSNEASINRKNRDTPPNHSQLKCNSNLEITIPKSLKLKDSEKV
DEKQLVIDAGHKRFGAVSCNICGMLYTASNPEDETQHLLFHNQFISAVKYVGWKKERILA
EYPDGRIIMVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVG
CLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRR
KKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNTT
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgtccattcaggagaaatcaaaagaaaattcctccaaagttattaaagaaagtgaaggt
gagaatttagaacaagaaatcgaaggttctcaaaacagcctagcaaagaaatcaggctcc
aaggaagctggaaagtcagcggttagattttccaacaaaagtaaagtaaatcagtctgaa
attggaacacgaatgagtacaaggtcagcatcatgttcagctgataaaaatgctactaac
tccattaataaaaatatggtatctgtgaagggacaatcacaagaatctttaaaaaagaag
aaattatgtcaggaaaaattatcatttggaaccttcaaagggagtgagcaacttaaccgc
agatcacaaagactacaacagttaacggagtctttaactaggtctttgcgcagtagagag
attcagggtcaaattcaaacagtaaaacagaatttgcaaccagcaagaagagaacagtgt
aacagtactcaaagtaaatgtaataaagtaaatcaaaagcatgtgaaaagaaaagtgctt
gaaataaagtctgattgtaaggaggacagacattcagttacaaatgaagtaataaattct
cccaaaggaaagaagcgcaaagtacagcatcagacaacttctacttgtagttctcagtgc
atccaaggatctgaaaaatgtctccagaagactattagaaaagaagaaacaaaacctgtg
cctgtaactgctgagattagaaaactaaaaacagctacatcagtggtctctaaaaggaat
gaactgaggaaatcagctcatacacaagtgagtgctagcacaaagtttccccaaatccca
ctgccgttagtgcctgaacacagtgttgaccatgaattggagcaacctggaaagagcaaa
agaggcagcattctccaactttgtgaagagattgctggagaaattgaatcagacactgta
gaggtaaaaaaggaatcctgtgtggaaagtgtaaaggaggagaagcctgcagaagtaaaa
ttggaagagactgatgctgaaagacaaacactccatcagaaagaaacaaaccaggacgtg
cagtgcaatcgtttctttcccagtaggaaaacaaagcctgtgaaatgtgtactaaatgga
ataaatagttcaactaagaagaactccaactggactaaaattaaactctcaaaatttaac
tctgtgcatcaacataaattggactctcaagtgtctcctaagttgagcttattacaaact
tttttgtcaccaccagttttagaaatgcctcatccagtgtctcaaagcacgtttttagag
atgaaaccgcatggtactgtaacttgccaacaagataaaatgaaaggaattaaatctgaa
gatgttaaaattaataatattgcaattgaaattaataaagccacaaaaagggctcctgga
aattgtaatttggataatcatattaaaccctcttctgactcatcattggataatcagatg
aaacattcttgtgagtcagcaccagatcagaatttcagcatatgttcagcgtcagaggtg
gagactaatccactagaaaacactgctgctgtctcaactcttctcagtcaagctaggatt
gatggggacagaaaatttccaggttcagctcctaatcagcagcacagtatactcagtaat
gaagcatctatcaacagaaagaacagagatacaccgccaaatcattctcagctgaagtgt
aattctaatctagagataacaattccaaagtccttaaaactgaaagactcagagaaagtg
gatgaaaaacagctggttatagatgcaggacacaaaagatttggagcagtgtcctgtaat
atctgtgggatgctttatacagcttcaaatccagaagatgaaacccagcacctgcttttc
cacaaccagtttataagtgctgtaaagtatgtgggctggaaaaaagaaagaattctggct
gaatatcctgacggtaggataataatggttctccctgaagatccaaagtatgccctgaaa
aaggttgatgaaattagagagatggttgacaatgatctgggtttccaacaggctccatta
atgtgctattccagaactaaaacacttctctttatttctaatgacaaaaaagtagttggt
tgcctaattgcagaacatatccagtggggctatcgagttatagaagagaaacttccagtt
atcagatcagaagaagaaaaagtccgatttgaaaggcaaaaagcctggtgctgctcaaca
ttgccagagcctgcaatatgtgggatcagtcgaatttgggtgttcagcatgatgcgacgg
aaaaagatagcttctcgcatgattgaatgcctaaggagtaactttatttatggctcatat
ttgagtaaagaagaaattgctttctcagatcccactcctgatggaaagctgtttgcaaca
cagtactgtggcactggtcagtttctggtctataattttatcaatggacagaataccacc
taa

DBGET integrated database retrieval system