KEGG   Rattus norvegicus (rat): 680066
Entry
680066            CDS       T01003                                 

Gene name
Lemd3, RGD1561001
Definition
(RefSeq) LEM domain containing 3
  KO
K19410  inner nuclear membrane protein Man1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    680066 (Lemd3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    680066 (Lemd3)
SSDB
Motif
Pfam: MSC LEM RBM39linker
Other DBs
NCBI-GeneID: 680066
NCBI-ProteinID: NP_001177929
RGD: 1596822
Ensembl: ENSRNOG00000024027
UniProt: F1LWZ8
Position
7q22
AA seq 914 aa
MAAAAATAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQQQHR
AGGRGNKTRNSNNNNTAAAASVAAAPAGMGVRPGSGDFAYLRTPAGLGRLSASAPESPAG
GSGVAAAVPAAGSKVLLGFSSDESDVEASPREQAGGGGARRDRAALQYRGLKAPPAPPVA
GEATSGNSAERRKPHSWWGARRPVGPEPQLPSGSDGAAEDVDEEVADGEDRDPEAEEPLW
GSRAVNGSRLLPYSCREHYSDSEEEDDGGDVASARQVLKDDSLSRHRPRRSHSKPFSALT
AKSGGSRQETSVQGGGGLAMNDRAAAAGSLDRSRNLEEAAAEPGGGGGGGGCDQVDSIPR
YRAGAKKLAPLLSPPSPDVDSTLESPTGPLKTNNHIGGGGAFGVDSPSLYANSIPPGAAA
TAPGSLRINHANHTGSNHTYLKNAYSKPKLCEPEEELLQQFKREEVSPTGSFSAHYLSMF
LLTAACLFFLILGLTYLGMRGTGVPEDGRLLKNPFDETFGKIQASEKNLMMSTLYKLHDR
LAQIAGDHECGRSSQRMLSVQEAAAYLKDLGPEYEDVFNTSLLWIFKNGKDVGIRCVGYG
PEEDLTNITDVQFLQSTRPQMPFWCRFRRAFITVTHRLLLLCLGVVLVCAVLRYMRYRWT
KEEEETRQMYDMVVKIIDVLRSHNEACQETKDLQPYMPIPHVRDSLIQPQDRKKMKKVWE
RAVDFLAANESRVRTETRRVGGADFVVWRWVQPSASCDKTSVIPSKVWQGQAFHLDRRNS
PPNSLTPCLKIRNMFDPVMEIGDHWHLAIQEAILEKCSDNDGIVHIAVDRNSREGCVYVK
CLSPGHAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTCSTPLKPSDKHMNSMSH
LRLRTGLANSQGSS
NT seq 2745 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctacggcggcttcggcgcctcagcagctctcagatgaggagctt
ttctctcagctccgccgttacggcttgtctccgggtcccgtgacagagagcactcggccg
gtctacctcaagaagctgaagaagcttcgcgaggaagagcagcagcagcagcagcaccgg
gcggggggccgcggcaacaagacgcggaacagtaataacaataacacggcggccgcggcg
agtgtagccgcggcaccggcggggatgggggtccggccgggctcgggggacttcgcgtac
ttacggactcccgcgggcctcggccgcctgtcggcctccgctccggagagccccgcggga
ggctccggggtcgcggcggccgtccccgcggcgggcagcaaagtgctgctgggctttagc
tccgacgagtcggacgtggaggccagtccgcgggagcaggcgggcggcggcggagcgcgg
agggaccgggctgctctccagtaccgcgggctcaaagcgccaccggcgcccccggtcgcg
ggtgaggcgacgagcggcaactcggccgagcggaggaagccccactcgtggtggggggcg
cggaggccggtgggccccgagccgcagctcccgtcggggagcgacggggccgcggaggac
gtggacgaggaggtagcggacggtgaggacagggacccggaggcggaggagccgctgtgg
ggcagccgagccgtgaacggcagccggcttctcccctacagctgccgggagcattactcg
gactcggaggaggaggacgacggcggcgacgtggcctcggctagacaggtattaaaggac
gactccctttcccggcatcgacccagacggagccatagtaagccgttctccgcgctgact
gctaaatctggcggcagccggcaggagacttcagttcagggagggggaggactcgcgatg
aatgacagggcggcggctgcggggagtctagacaggagccgaaacctcgaggaggcggcg
gccgagccgggaggcggaggaggaggaggagggtgcgatcaagtggactccattcctcga
taccgtgctggcgcgaagaagctggcaccgctcctgtcgccgccgagtcccgacgtggac
tcaaccttggagtcgcccacagggcccctcaaaaccaataatcacataggcggcggcggg
gccttcggcgtggattcccccagtctgtatgccaacagcatccctcccggagcggccgcg
accgcccctggttcactcaggatcaaccacgccaaccatacgggctccaatcatacctac
ctgaaaaacgcctacagcaagccaaagctctgcgagcccgaagaggaacttctccagcag
tttaaacgtgaggaggtgtctccgacggggagtttcagtgctcactacctgtcgatgttc
ctcctaactgcagcctgcttatttttcctaatattgggactgacttacctaggaatgaga
gggacaggagtacccgaggacggaagactcttaaaaaacccctttgatgaaacatttgga
aaaatacaagcaagtgaaaaaaatcttatgatgagcacattatacaaacttcatgatcga
ttggctcagattgcaggagatcatgaatgtggccgttccagccaaaggatgctttctgtc
caagaagcagctgcatatttaaaagatttaggtcctgagtatgaagatgtatttaacact
tcactgctgtggatttttaaaaatgggaaagatgttggaataaggtgtgttggttatgga
cctgaggaagacctgacaaacataaccgatgtgcagtttttacagtccaccagaccacag
atgccgttctggtgccgtttccgccgtgctttcattaccgtgacccataggttactgctg
ttgtgcttaggtgtagtcctggtctgtgctgtcctccgttatatgagataccgctggacg
aaggaggaagaagagacaaggcagatgtatgacatggtggtgaagatcatagatgtttta
cgaagtcataatgaagcctgtcaggaaactaaggacttacagccttacatgcctattcca
catgttcgagattccctaatacagccccaggacaggaaaaagatgaagaaagtgtgggaa
agagctgttgacttccttgctgctaatgagtctagagtgcgaacagagactcgaagagtg
ggtggtgcagacttcgtagtctggcggtgggtccagccttctgcatcttgtgacaagacg
tcagtcataccctctaaagtatggcaaggtcaagcatttcatttagatagaagaaattca
ccaccaaatagtttgacgccatgtttaaagattcggaatatgtttgacccagttatggaa
ataggagatcactggcatctggcaattcaagaagcaattttagagaagtgcagcgataac
gacggcattgttcatatcgcggtagacaggaactcccgtgagggctgcgtgtatgttaag
tgtctgtctccgggacatgctgggaaggcttttaaagccctgcacggctcctggttcgat
ggaaaattggtaacagtaaaatacttacgactagatagataccaccaccgcttcccccag
gctcttacgtgcagcactcccttgaagccatcagacaaacacatgaactccatgtctcac
ctgcgcctgcgaactggcctagctaattctcaaggaagttcctga

DBGET integrated database retrieval system