KEGG   Rattus norvegicus (rat): 680127
Entry
680127            CDS       T01003                                 

Gene name
Tirap
Definition
(RefSeq) TIR domain containing adaptor protein
  KO
K05403  toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno05132  Salmonella infection
rno05133  Pertussis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    680127 (Tirap)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    680127 (Tirap)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    680127 (Tirap)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    680127 (Tirap)
   05133 Pertussis
    680127 (Tirap)
   05152 Tuberculosis
    680127 (Tirap)
  09172 Infectious disease: viral
   05161 Hepatitis B
    680127 (Tirap)
SSDB
Motif
Pfam: TIR_2 TIR
Other DBs
NCBI-GeneID: 680127
NCBI-ProteinID: XP_001055833
RGD: 1595496
Ensembl: ENSRNOG00000021420
UniProt: D3ZXA5
Position
8q21
AA seq 250 aa
MVGLEACAMASSSSVPASSTQSKKPRDKIADWFRQALLKKPKKMPISQESHLSDGSQTAT
QDGLSPSSGSSPRSHSSSQSQSSTPSCSSGMSPTSPPTHVDSSSSSSSGRWSKDYDVCVC
HSEEDLEVAQELVSYLEGSKASLRCFLQFRDAAPGGAIVSELCQALSGSHCRVLLITPGF
LRDPWCKYQMLQALTEAPGSEGCTIPLLSGLTRAAYPPELRFMYYVDGRGQDGGFYQVKE
AVIHYLETLS
NT seq 753 nt   +upstreamnt  +downstreamnt
atggttggtttggaggcctgtgctatggcttcatcctcctccgtcccagcctcctccact
cagtccaagaagcctcgagacaagatagctgactggttcaggcaggctctgttgaagaag
cccaagaagatgccaatctcccaggaaagccacctcagtgatggttcacagacagccaca
caggatggtctctcaccctccagcggcagttcacctcggagtcatagttcatcccagagc
caaagctcaaccccgagctgcagttcaggaatgtctcctacctcaccaccaacacacgtg
gacagcagcagcagcagcagcagtggccgttggagcaaagactatgatgtctgtgtgtgc
cacagtgaggaggatttagaggtggcccaggagcttgtctcctacttggagggtagcaaa
gccagtctacgctgcttcctgcagtttcgggatgcagccccaggtggcgccattgtttct
gagctatgccaggcgctgagtggtagtcactgccgcgtgctgctcatcaccccaggcttc
cttcgggacccctggtgcaagtaccagatgctgcaggccctgacggaagccccagggtcg
gagggatgcactatacccctgctatccggcctgaccagagccgcctatccaccggaactc
cgattcatgtactatgtggatggcagaggccaggatggtggcttttatcaagtcaaggag
gctgttatacactatctggagacactaagttga

DBGET integrated database retrieval system