KEGG   Rattus norvegicus (rat): 680130
Entry
680130            CDS       T01003                                 

Gene name
Timp4
Definition
(RefSeq) tissue inhibitor of metalloproteinase 4
  KO
K22584  metalloproteinase inhibitor 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    680130 (Timp4)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I35: timp family
   680130 (Timp4)
SSDB
Motif
Pfam: TIMP
Other DBs
NCBI-GeneID: 680130
NCBI-ProteinID: NP_001102863
RGD: 69077
Ensembl: ENSRNOG00000007955
UniProt: P81556
Position
4q42
AA seq 224 aa
MPWSPLAALSWALVLRLLALLWPPGRGEACSCAPAHPQQHVCHSALVIRAKISSEKVVPA
SEDPADTQKMIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSQKQYLLTGQI
LSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPDECLWTD
WLLERKLYGYQAQHYVCMKHVDGICSWYRGHLHLRKEYVDIVQP
NT seq 675 nt   +upstreamnt  +downstreamnt
atgccctggagtcccctggctgcgctgagctgggcgctggtgctgaggctgctggctttg
ctgtggccccctggacggggtgaggcgtgcagctgcgcgcctgcgcacccccagcagcac
gtctgccactctgctttagtaatacgggccaaaatatccagtgagaaggtagtccctgcc
agtgaagaccccgctgacactcaaaaaatgatccggtatgaaatcaaacagataaagatg
tttaaagggttcgagaaggccaaggatattcagtatgtctacacgccatttgactcttct
ctctgtggtgtgaaactagaaaccaacagtcagaagcagtatctgttgactggccagatt
ctcagtgatggaaaagtcttcatccatctgtgcaactacattgagccctgggaggacctg
tccttggtgcagagggagagcctgaatcatcactaccaccagaactgtggctgccaaatc
accacttgctatgcagtgccgtgtaccatctcagcccccgatgagtgtctctggacagac
tggctgctggaacggaagctctatgggtaccaggcccagcactatgtctgcatgaagcat
gttgatggcatctgcagctggtaccgaggacacctacacctccggaaggagtacgttgac
atcgtccagccctag

DBGET integrated database retrieval system