KEGG   Rattus norvegicus (rat): 680133
Entry
680133            CDS       T01003                                 

Gene name
Tbc1d8, IHoP
Definition
(RefSeq) TBC1 domain family, member 8
  KO
K19951  TBC1 domain family member 8/9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    680133 (Tbc1d8)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    680133 (Tbc1d8)
 Endosome - Golgi transport
  Rab GTPases and associated proteins
    680133 (Tbc1d8)
SSDB
Motif
Pfam: RabGAP-TBC GRAM
Other DBs
NCBI-GeneID: 680133
NCBI-ProteinID: NP_001177996
RGD: 1595491
Ensembl: ENSRNOG00000013583
UniProt: F1LWZ7
Position
9q22
AA seq 1135 aa
MWLKPEEVLLKNALKLWVTQKSSCYFVLQRRRGHGEGGGRLTGRLVGALDAVLDSSARVA
PFRILLQVPGSQVYSPIACGATLEEINRHWDWLEQNLLHTLSVFDNKDDIASFVKGKVKA
LIAEETSSRLAEQEEEPEKFREALVKFEARFNFPEAEKLVTYYSCCCWKGRVPRQGWLYL
SINHLCFYSFFLGKELKLVIPWVDIQKLERTSNVFLTDTIRITTQNKERDFSTFLNLDEV
FKIMEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLH
AVVDCSLWTPFSRCHTAGRIFSSDSYICFASREDGCCHVVLPLREVVSIEKMEDTSLLPN
PIIVSIRSKMAFQFIELKDRENLVEGLLLRLKQVHANHPVHYETSPSDDDMASPVFYSTS
ICTDKFGDLEMVSSQSSEEREKEKSPLPHPEPLTAVFQQSGSQSPDSRLSREQIKISLWN
DHFAEYGRTVCMFRTEKIRKLVAMGIPESLRGRLWLLFSDAVTDLASHPGYYGNLVEQSL
GRCCLVTEEIERDLHRSLPEHPAFQNETGIAALRRVLTAYAHRNPKIGYCQSMNILTSVL
LLYAKEEEAFWLLVAVCERMLPDYFNHRVIGAQVDQSVFEELIKEHLPELAEHMSDLSAL
ASISLSWFLTLFLSIMPLESAVNVVDCFFYDGIKAIFQLGLAVLEANAEELCSSKDDGQA
LMILSRFLDHIKNEDSPGPPIGSHHAFFSDDQEPCPVTDIADLIRDSYEKFGNQSVEQIE
HLRCKHRIRVLQGHEDTTKQNVLRVVIPEVSILPEDLEELYDLFKRAHMMNCYWEHHRPI
ALRHDPSRPYAEQYRIDACQFAHLFQLVSPWTCGAHTEILAERIFRLLDDNMDQLIEFKA
FVSCLDVMYNGEMSEKIKLLYRLHIPPALTENDRDSQSPLKNPLLSTSRPLVLGRPNGDT
IDYQKQLKQMIKDLAKEKDKMEKELPKMSQREFIQFCKTLYSMFHEDPEENDLYQAIATV
TTLLLQIGEVGQRGSSSGSCSQECEEPQASAPPEQDSVFAEAGKSPQAFPETEGDWTVSL
EHILASLLTEQSLVNFFEKPLNIKSKLENAKLNQYSLKAMEMSHPSQPELKLNSL
NT seq 3408 nt   +upstreamnt  +downstreamnt
atgtggctcaagcccgaggaggtgctgctcaagaacgcgctgaagctctgggtgacccag
aagagcagctgctacttcgtcttgcagcggcgccgcgggcacggcgaggggggcggccgc
ctcaccggtcgcctggtgggtgctctggacgcggtgctggattccagcgcacgggttgct
ccatttcggattctgcttcaagttcccgggtcccaggtgtattctcccatagcatgtggt
gcaacgttggaggaaatcaaccggcactgggactggctggagcagaacctgctgcacacc
ttgtcagtcttcgacaacaaagatgacatcgccagctttgtcaaagggaaggtgaaggct
ctgatcgctgaggagaccagcagcagactggcagagcaggaggaggagcctgagaagttc
cgagaagccctggtgaagttcgaggccaggttcaacttccccgaggcagagaagctggtc
acctactactcttgctgctgctggaagggccgggtgccccgccagggctggctgtacctc
agtatcaaccacctctgcttctattccttcttcctgggcaaggaacttaaacttgtcatc
ccctgggtcgacatccagaagctggagcgaacatccaatgtctttctcacggacaccatc
cggatcactacacagaataaggagcgagacttctccacgtttctgaacctggacgaggtc
tttaagatcatggagcagctggcagatgtcacactccggaggctgctggacaacgaggtc
tttgatttggaccctgacctgcaggagcctagtcagatcaccaagagggacctggaggcc
agagcgcagaatgagttcttccgggctttcttcaggttgccgaggaaggagaagctgcac
gctgtggtagactgttccctctggacgcccttcagtcgctgccacacggccgggaggata
ttctcctctgacagctacatctgctttgccagcagagaggatggctgctgtcacgttgtg
cttcccctgagagaggtagtcagcattgagaagatggaagacacgagcctgctgcccaac
cccatcattgtgagcatccgcagcaagatggccttccagttcattgagctcaaggacaga
gaaaacttggtagagggcctgctgttgagactgaagcaggtccatgccaaccaccctgtg
cattatgagacctcaccaagtgatgatgacatggcttcacctgtgttttactcaacaagc
atctgcaccgacaagtttggggatcttgagatggtgtcttctcaaagtagcgaagagaga
gagaaggagaagagccccctgccacatcctgagcccctgactgccgtcttccagcagtct
ggcagccagagtcctgactcccgcttgtcccgggagcagataaaaatcagtctgtggaat
gaccactttgcagagtacggcaggaccgtgtgcatgttccgcactgaaaagatccggaag
ctggtggccatggggattcccgagtctttacgtggaaggctgtggctgcttttctcagat
gctgtgacggacctggcctcacaccctgggtactatgggaatctggtggagcagtcgtta
ggacgctgctgcttggtgacagaggagatagagagggacctgcaccgctctctgcctgag
caccctgccttccagaatgaaactggtattgctgccttgaggcgggtgctgacagcttat
gctcaccggaaccccaagattggatactgccagtccatgaacatcctgacctctgtgttg
ctgctgtacgccaaggaggaggaagccttctggctgctggtggctgtgtgtgagcggatg
ctgcctgattacttcaaccaccgggtgatcggggctcaggtggaccagtctgtgtttgag
gagctcatcaaggagcaccttccagagttggccgagcacatgagcgacctgtcggccttg
gcgtccatctctctctcctggttcctgactctgttcctcagtatcatgcctctggagagt
gccgtgaacgtcgtcgattgcttcttctatgatgggatcaaggccatcttccagctgggg
ctggctgtgctggaagccaacgcagaggaactgtgcagtagcaaagatgacggacaggcc
ctgatgatcctcagcaggtttctagatcacattaagaatgaagacagcccggggcccccc
attggcagccaccatgcctttttctctgatgatcaggagccctgtcctgtgaccgacatt
gctgacctgatccgggactcctatgagaaatttggaaaccagtctgtggagcagattgag
catctacgctgcaagcacaggatcagggtcctgcaaggccacgaggacaccaccaagcag
aacgtgctccgtgttgttatcccagaagtctccattcttcctgaggacctcgaggaactc
tatgacttattcaagagagcacacatgatgaactgttactgggagcatcacaggcccata
gccctgcgccatgatcccagcaggccctatgctgaacagtaccgcatcgatgcctgccag
tttgcacacctattccagttggtatcgccatggacctgcggggcccatacagagatcctt
gctgagaggatcttcaggcttctggatgacaacatggaccagctcatagagttcaaagcc
ttcgtaagctgtctagacgtgatgtacaatggagagatgagtgagaagatcaagctgctc
tacaggcttcacatccccccagcactcactgaaaatgacagagacagccagtcgccattg
aagaatcctctgctgtcaacttcaagacccctggtattgggcaggcccaatggtgacaca
attgattatcagaaacaactgaaacagatgattaaggatttagccaaagaaaaggataaa
atggagaaagagttgcccaaaatgagtcagagagaatttatccagttctgcaaaactctg
tacagtatgttccatgaggatccagaggaaaatgatctgtatcaagccatcgccacagta
accactctgctgctgcagatcggagaagtgggccagcgaggtagcagctcaggaagctgc
tcccaagaatgtgaggagccgcaggcctcagctcctcctgaacaggactcagtttttgct
gaggctgggaagagtccccaggccttccctgagacggaaggggactggaccgtgtccctt
gaacacatcttggcgtcccttctcactgagcagtcactggtgaatttttttgaaaagcca
ctcaacattaaatccaaacttgaaaatgccaagctcaatcagtacagtctcaaagcaatg
gaaatgagccacccatcacagccagagctgaagctgaatagcctgtaa

DBGET integrated database retrieval system