KEGG   Rattus norvegicus (rat): 680201Help
Entry
680201            CDS       T01003                                 

Gene name
Zfp322a
Definition
(RefSeq) zinc finger protein 322a
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 C1_4 zf-met Ta0938
Motif
Other DBs
NCBI-GeneID: 680201
NCBI-ProteinID: NP_001128556
RGD: 1594230
Ensembl: ENSRNOG00000017318
UniProt: D3ZJ04
Position
17p11
AA seq 399 aa AA seqDB search
MYTSEEKCNQRTQKRKIHHVCPQKGKKIYIRVHEITQIDNQIYQCLEREQNFCENLAQMC
ERTYTGEKPYRCDMCEKTFIQSSDLISHQRIHNYEKPYKCSKCEKSFWHHLALSGHQRTH
AGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCNECDKCFSRSTNLIRHRRTHTGEK
PFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSYRHRSAFIVHKRVHTGEKPYKC
SACEKCFGQKSDLIVHQRIHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEKS
FNSSSDFIVHQRIHMEEKPHQWSMCESGFLLGMDFVAQQKMRTQTEELHYKYGACNKSFH
HSSALLQHQTVHIDDEYICNMSEKGLDLSSHASETSRMS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtacacttcagaagagaaatgtaaccagagaactcagaaaaggaaaatacaccatgta
tgccctcagaaggggaaaaagatatatattcgtgtacatgagattactcaaatagataat
caaatatatcagtgccttgaacgtgaacaaaacttttgtgaaaacttagcacaaatgtgt
gaaagaacatatactggggagaaaccttatagatgtgatatgtgtgagaaaaccttcatc
caaagttcagatcttatttcccaccagaggatccataattatgaaaaaccttataaatgt
agcaaatgtgagaagagcttttggcaccacttagccctttcaggacaccagagaacacat
gcaggtaaaaagttttacacctgtgacatctgtggcaagaattttggtcagagctctgat
ctgcttgtccatcagcgaagccatacaggtgaaaaaccttatctgtgtaacgaatgtgat
aaatgcttcagtcgaagtacaaatctcataaggcaccgaagaactcacacaggtgagaaa
ccatttaagtgtctggaatgtgaaaaagcttttagtggaaaatcagatcttattagccac
caaaggactcatactggtgaaaggccctacaaatgcaataaatgtgagaaaagttaccga
cataggtccgccttcattgtgcataaaagagttcatactggagagaagccgtataagtgt
agtgcctgtgagaagtgctttggccagaaatcagaccttatcgtacaccagagaatccac
acaggtgagaaaccttataaatgcttggagtgtatgagaagttttactcggagtgccaac
ctcattaggcaccaggcaactcacactcatactttcaaatgccttgaatatgagaaaagt
ttcaacagtagctcagactttattgtacatcagagaattcatatggaagaaaaaccacat
caatggtctatgtgtgagagtggcttcctcctaggtatggacttcgttgcccagcagaaa
atgaggactcaaacagaggagctccattataaatatggtgcatgtaataaaagctttcat
catagctcagcccttcttcaacatcagacagtgcacattgatgacgaatacatctgtaat
atgagtgaaaaagggcttgatctcagctctcatgcatcggaaacctcaaggatgtcttga

DBGET integrated database retrieval system