KEGG   Rattus norvegicus (rat): 680203
Entry
680203            CDS       T01003                                 

Gene name
Pcdhb20, Pcdhb14
Definition
(RefSeq) protocadherin beta 20
  KO
K16494  protocadherin beta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    680203 (Pcdhb20)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Protocadherins
   680203 (Pcdhb20)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_C_2 Cadherin_3 InlK_D3 REJ
Other DBs
NCBI-GeneID: 680203
NCBI-ProteinID: NP_001102865
RGD: 1594228
Ensembl: ENSRNOG00000033123
UniProt: D4A7P5
Position
18p11
AA seq 799 aa
MGNRKTIILQKRQVLVFFVLLGLSRASAESLRYSVAEETEIGSFVANLARDLGLGVAELS
SREARIVSDDNKKHLLLNLLTGDVLLSERLDREELCGSTEPCVLPFQVVLEDPLQFYRAE
LHVRDINDHAPTFLDKEITIKIPESAAIGATFLIENAQDLDIGSNSLQDYSISPSSHFYV
KIHESGDGKIYPELVLDKALDHEEESELRLTLTALDGGSPPRSGTTLVLIKVLDINDNAP
EFAQNFYEVQVPEDTPIGSSIITISAKDLDMGNYGKISYSFLHATEDVRKTFEINPTSGE
VNLRSLLDFEVIQSYSVTIQATDGGGLSAKCTLSVKVLDINDNAPEVIISSVTKTIPENA
SETLITLFSVRDQDSGDNGRILCSIPDDLPFILKPTFKNFFTLLSEKALDRESRAEYNIT
ITVSDLGTPRLTTQHTITVQVSDINDNAPAFTQTSYTMFVHENNSPALHIGTISATDSDS
GSNAHITYSLMPPRDPQLALDSLISINADNGQLFALRALDYEVLQAFEFRVGATDRGSPA
LSSQALVRVVVLDDNDNAPFVLYPLQNASAPYTELLPRAAEPGYLVTKVVAVDRDSGQNA
WLSFQLLKATEPGLFSVWAHNGEVRTSRLLSERDAPKHKLLLMVKDNGDPPRSASVMLHV
LVVDGFSQPYLPLPEVAHNPAHDEDTLTLYLVIALASVSSLFLLSVLLFVGVRLCKKARA
ASLGGCSVPEGHFPGHLVDVTGTGTLSQNYQYEVCLTGSTGTNEFKFLKPVMPSLQLQDP
DSNMLVKENFRNSLGFNIQ
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgggaaacagaaagactatcatcctgcagaaacggcaagtcttggttttctttgttttg
ctgggattgtctcgggcgagtgctgagtctttgcgctattctgtagcagaggaaacagaa
attggctcttttgtggctaatctggcaagggatttagggctgggggttgcggagctgtcc
tccagggaggccaggatagtgtcagacgataataaaaagcatttactccttaatttgctg
accggagatgtgctcctgagtgagcgactggaccgtgaagagctgtgtggctccaccgag
ccctgtgtgctgccctttcaggtggtactggaagaccctttacagttctatcgagctgag
ctgcatgtcagagacataaatgatcacgcccctacattcctagacaaggaaataactatt
aaaataccagaaagcgctgctatcggagccacatttttaattgagaatgcacaagatctg
gacataggaagcaacagtctccaggactacagcattagccccagttctcatttctatgtt
aaaattcatgagagtggtgatggaaagatatatccagagctggtactggacaaagcttta
gatcatgaggaagaatctgagcttagattgacacttacagcattggatggcgggtctcca
cccaggtctgggacaacattagttctcataaaagtcttggacatcaacgataatgctcct
gagtttgctcagaatttctatgaggtgcaggtcccagaggacacacccattggctccagt
attattactatctctgctaaagatttagatatgggaaattatgggaaaatatcatattca
tttttgcatgcaacagaagatgttagaaaaacctttgaaatcaacccaacatctggggaa
gtcaatttgagatcactgctggattttgaagtaatacagtcctattctgtaactatccaa
gcaacagatggtggaggtctttcagcaaaatgcactctttcagttaaagtattagatata
aatgacaatgcaccagaagtgatcatatcatcggttacaaagacaattccagagaatgct
tcagagaccctgatcactctgttcagtgtccgagatcaagactctggagacaatggaagg
atcctttgctctattccggatgaccttccatttattctaaagcccaccttcaagaatttt
ttcactctactttctgaaaaagcactggacagagaaagtagagctgagtacaacatcacc
atcactgtctcagatctgggcacacccaggctcacaacccagcacaccataacagtgcag
gtgtctgacatcaacgacaacgcccccgccttcacccaaacctcctacaccatgtttgtc
cacgagaacaacagccccgccctgcacataggcaccatcagtgccacagactcagactca
ggctccaatgcccacatcacctactcgctgatgccgcctcgagacccacagctggccctc
gactccctcatctccatcaatgctgacaacgggcagctgttcgcactcagggcgctggac
tatgaggtgctgcaggccttcgagttccgcgtgggtgccacagacagaggctcacccgcg
ctcagcagccaggctctggtgcgcgtggtggtgctggacgacaatgacaatgcgcccttc
gtgctctacccgctgcagaatgcctcagcgccctacacagagctgctgcccagggcggca
gagcctggatacctggttaccaaggtggtagctgtggaccgcgactctggccagaatgcc
tggctgtcattccagctgctcaaagccacggagccggggctgttcagcgtgtgggcgcac
aatggcgaggtacgcacctccaggctgctgagcgagcgcgatgcacccaagcacaaactg
ctgctgatggtcaaggacaatggagatcctccgcgctctgccagtgttatgttgcacgtg
ctagtggtagatggcttctctcagccctacctgcctctgccagaggtggcgcacaatcct
gcacacgacgaggacactctaacactgtacctggtcatagccttggcatctgtgtcttct
ctcttcctcttgtctgtgctgctgttcgtgggggtgaggctgtgcaagaaggccagggca
gcttctctgggtggctgctctgtgcccgagggccactttcctggccacctggtggacgtt
accggcactggaaccctgtcccagaactaccagtatgaggtgtgtttgacaggaagtact
gggacaaacgagttcaaattcctgaagccagtcatgcccagtcttcaactccaggacccc
gattctaatatgctggtaaaggagaactttcggaatagcctgggttttaatattcaataa

DBGET integrated database retrieval system