KEGG   Rattus norvegicus (rat): 680229Help
Entry
680229            CDS       T01003                                 

Gene name
Sgcb
Definition
(RefSeq) sarcoglycan, beta
  KO
K12566  beta-sarcoglycan
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rno05414  Dilated cardiomyopathy (DCM)
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    680229 (Sgcb)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    680229 (Sgcb)
   05414 Dilated cardiomyopathy (DCM)
    680229 (Sgcb)
   05416 Viral myocarditis
    680229 (Sgcb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sarcoglycan_1
Motif
Other DBs
NCBI-GeneID: 680229
NCBI-ProteinID: NP_001177997
RGD: 1594202
Ensembl: ENSRNOG00000002135
UniProt: A0A0G2K1V7
Position
14p11
AA seq 320 aa AA seqDB search
MAAAAAAAAATEQQGSNGPVKKSMREKAVERRNVNKEHNSNFKAGYIPIDEDRLHKTGLR
GRKGNLAICVIVLLFILAVINLLITLVIWAVIRIGPNGCDSLEFHESGLLRFKQVSDMGI
IHPLYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVEKNKTSITSDIGMQFFDPRTQNI
LFSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGNEGVFIMGKT
IEFHMRGDVELKAENSIILNGTVMVSPTRLPSSSGGDQSGSGDWVRYKLCMCADGTLFKV
QVTSHNMGCQVSDNPCGNTH
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcggcagcagcggcggcggcgaccgagcagcaaggttccaacgggccagtg
aagaagtccatgcgggagaaggcagtggaacgaaggaacgtcaacaaagagcataacagc
aacttcaaagctgggtacattcccatcgatgaagaccggctgcataaaaccgggctgaga
gggagaaagggcaacctagccatctgtgtgattgtcctcctgtttatcctggctgtcatc
aacctgcttattacacttgtcatctgggccgtgattcgcattgggccaaatggctgtgac
agcttggagtttcatgagagcggtctgctgcgattcaagcaagtgtccgacatgggtatc
atccatccgctttataagagcacagtgggaggaaggcggaatgaaaacctggtcatcact
ggcaacaaccagccgattgtttttcagcaagggacaaccaagctgagtgttgaaaagaac
aaaacctccatcaccagcgacattggaatgcaattttttgacccaaggacacaaaatatc
ttattcagcacagactatgagactcatgagtttcacctgccaagcggagtgaaaagtttg
aacgttcagaaagcgtcaactgaaaggatcaccagcaacgctaccagtgacttgaacatc
aaagtcgatgggcgtgcaattgtgcgaggcaatgaaggcgtgttcatcatgggcaaaacc
attgaatttcacatgcgaggggatgtggaactaaaggctgaaaacagcatcatcctcaat
ggcactgtgatggtcagcccaacgcgtctgcccagctcctccggcggagaccagtcaggc
agtggtgactgggtgcggtacaagctctgcatgtgtgcagacggcacactcttcaaagta
caagtaacaagccacaacatgggctgccaggtctctgacaacccttgtggaaacacgcat
tag

DBGET integrated database retrieval system