KEGG   Rattus norvegicus (rat): 680312Help
Entry
680312            CDS       T01003                                 

Gene name
Hist1h2bk, Hist1h2bc
Definition
(RefSeq) histone cluster 1 H2B family member k
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    680312 (Hist1h2bk)
  Immune diseases
   05322 Systemic lupus erythematosus
    680312 (Hist1h2bk)
  Substance dependence
   05034 Alcoholism
    680312 (Hist1h2bk)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    680312 (Hist1h2bk)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   680312 (Hist1h2bk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 680312
NCBI-ProteinID: NP_001102870
RGD: 1593016
Ensembl: ENSRNOG00000055512
UniProt: G3V9C7
Position
17p11
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacctgccaagtccgcccccgcaccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgtaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtacacccggacacgggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatctttgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcactacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgttgcttcctggggagctggccaagcacgcggtgtccgagggcaccaaggccgtcacc
aaatacaccagcgctaagtaa

DBGET integrated database retrieval system