KEGG   Rattus norvegicus (rat): 680338Help
Entry
680338            CDS       T01003                                 

Gene name
Clec12a
Definition
(RefSeq) C-type lectin domain family 12, member A
  KO
K17516  C-type lectin domain family 12 member A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    680338 (Clec12a)
   04090 CD molecules [BR:rno04090]
    680338 (Clec12a)
   04091 Lectins [BR:rno04091]
    680338 (Clec12a)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   680338 (Clec12a)
CD molecules [BR:rno04090]
 Proteins
  680338 (Clec12a)
Lectins [BR:rno04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   680338 (Clec12a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C UL45 SMP_2
Motif
Other DBs
NCBI-GeneID: 680338
NCBI-ProteinID: NP_001128188
RGD: 1592991
Ensembl: ENSRNOG00000054860
UniProt: B4F798
Position
4q42
AA seq 269 aa AA seqDB search
MSEEIVYADLKFQDSDKKEESQKSDKCGRKVPSAGSYSQHKTVLILILLCLLLFIGVVAL
GCIFYTTLETEMIKSNQLQRVKEELQENVSLQLMHNLNNSKKIKTLSAMLQNIATQLCQE
LSKKEPGHKCKPCPKASDWYKDSCYSRFQKYATWQESVEFCSARNASLLKVKNKDELEFI
KSKELYNYWLALPPSKMYRSYELLSEKMFLSEGFKRSTYDITKMSCGFIRGEYVYYTNCD
EEKYTMCEETASKVQVESVLSDLPEGSIL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggaaattgtttatgcagatctcaaattccaggactctgataagaaagaagaa
agccagaagtctgacaaatgtgggagaaaagtaccttctgctggttcctattcacaacat
aaaacagtcttgattctgattcttctatgccttctgctgtttattggagtggtggcctta
ggatgcatcttttatacaactttggagacagaaatgataaagtcaaatcaattacaaaga
gtcaaggaagaacttcaggaaaatgtttccctacagctgatgcacaatctcaacaactcc
aagaaaatcaagactctttctgctatgctgcaaaacatagccacccagttgtgtcaagaa
ctgtcaaagaaagaaccaggtcataaatgtaaaccatgtccaaaggcttcagattggtac
aaggacagctgttattctcgattccagaagtatgcaacatggcaagagagtgttgagttc
tgctctgctcggaatgccagcctcctgaaggttaagaacaaggatgagctggaatttata
aagtccaaggagctatacaattattggctagcattgcctccaagtaaaatgtatagatct
tatgagctactgagtgagaagatgttcctctctgaagggtttaaaagaagcacatatgac
ataactaagatgtcctgtggctttataaggggggaatatgtttattatacaaactgtgat
gaagagaaatataccatgtgtgaagagacagccagcaaggtacaggtggaaagtgtgcta
agtgaccttccagagggtagcattctgtag

DBGET integrated database retrieval system