KEGG   Rattus norvegicus (rat): 680403Help
Entry
680403            CDS       T01003                                 

Gene name
Hist1h2bcl1, Hist1h2bc
Definition
(RefSeq) histone cluster 1, H2bc-like 1
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    680403 (Hist1h2bcl1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    680403 (Hist1h2bcl1)
  09165 Substance dependence
   05034 Alcoholism
    680403 (Hist1h2bcl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680403 (Hist1h2bcl1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    680403 (Hist1h2bcl1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    680403 (Hist1h2bcl1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   680403 (Hist1h2bcl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 680403
NCBI-ProteinID: XP_008769991
RGD: 1591796
Ensembl: ENSRNOG00000059382
UniProt: G3V8B3
Position
17p11
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcctgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaaaaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtacacccggacacgggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgcttcccggggagttggccaagcacgcggtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system