KEGG   Rattus norvegicus (rat): 680424
Entry
680424            CDS       T01003                                 

Gene name
Pex10
Definition
(RefSeq) peroxisomal biogenesis factor 10
  KO
K13346  peroxin-10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    680424 (Pex10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    680424 (Pex10)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    680424 (Pex10)
SSDB
Motif
Pfam: Pex2_Pex12 zf-C3HC4_3 zf-RING_2 Prok-RING_4 zf-C3HC4 zf-C3HC4_2 zf-rbx1 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 zf-RING_4 zf-ANAPC11 DUF3290 Zn-C2H2_12
Other DBs
NCBI-GeneID: 680424
NCBI-ProteinID: NP_001102875
RGD: 1591776
Ensembl: ENSRNOG00000024012
UniProt: D3ZC81
Position
5q36
AA seq 324 aa
MAQAGPPEVIRAAQKDEYYLGGLRSAAGGALHSLAGAKKWLEWRKEIELLSDIAYFGLTT
IAGYQTLGEEYVGIIQVDPSRQRVPSRLRRGVLVALHAVLPYLLDKALLPLEQELQAEGD
GTRASQGSLLPGGRSRSGARRWVRHHAATLTEQQRRALQRAVFILRQGFACLHRLHVAWF
YIHGTFYHLAKRLAGITYLRTRRLPGEDLRACTSYRLLGLISLLHLALSLGLQLYSFRQK
QRARKEWRLHRNLSHRRSSLEDRAVCRAPLCTLCLEERRHSTATPCGHLFCWECITEWCN
TKTECPLCREKFPPQKLVYLRHYR
NT seq 975 nt   +upstreamnt  +downstreamnt
atggcgcaggcgggtcctccagaagtgatccgggcggcgcagaaggacgagtactacctg
ggaggcctgcggagcgcggcgggtggagcgctgcacagcctagcgggtgcaaagaaatgg
ctggaatggaggaaagagatcgagttgctctcagacatagcctactttggcctcaccaca
attgcaggctaccagacacttggagaggagtacgtcgggatcatccaagtggacccatcc
cggcagcgtgtgccctccaggctccgacgtggagtgctggttgccctgcatgctgtcttg
ccctacctgctagacaaggcactgctgcccctggagcaggagctgcaagctgagggcgac
ggcacccgggcctcccaggggagtctgctacccggaggacgcagccggtcaggggcacgg
cgctgggtgcgtcaccacgcagctaccctgactgaacaacagaggagggccctccagcgg
gcagtctttatcctgagacagggcttcgcctgcctccaccggctccatgtggcttggttt
tatatccatggtaccttctaccacctggccaagagactggcagggatcacttatctccgc
actcgccgcctgccgggagaggacctgagggcttgcactagctaccgactgctgggactc
atctccctgctgcatctggcattgtcactggggctgcagttgtacagcttcaggcagaag
cagcgagccaggaaggagtggaggctgcaccgaaatctgtcccaccgcaggagttccctt
gaggacagagcagtttgtagagccccactctgcaccctgtgcttggaggagcgaagacac
tccacagccacaccttgtggccatctcttctgctgggagtgcattaccgagtggtgcaac
accaagacagagtgtcccctatgccgggagaagttcccaccccagaagctggtctacctg
aggcactaccgctga

DBGET integrated database retrieval system