KEGG   Rattus norvegicus (rat): 680451
Entry
680451            CDS       T01003                                 

Gene name
Nrbp2
Definition
(RefSeq) nuclear receptor binding protein 2
  KO
K08875  nuclear receptor-binding protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    680451 (Nrbp2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  NRBP family
   680451 (Nrbp2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr OSR1_C Beta-lactamase
Other DBs
NCBI-GeneID: 680451
NCBI-ProteinID: NP_001128479
RGD: 1591749
Ensembl: ENSRNOG00000029535
UniProt: D3ZA69
Position
7q34
AA seq 491 aa
MAAPEPAPRRGREREREDESEDESDILEESPCGRWQKRREQVNQGNMPGIQSTFLAMDTE
EGVEVVWNELHFGDRKAFAAHEEKIQTMFEQLALVDHPNIVKLHKYWLDASEARARVIFI
TEYVSSGSLKQFLKKTKKNHKAMNARAWKRWCTQILSALSFLHACSPPIIHGNLTSDTIF
IQHNGLIKIGSALPDDLRSPIRTEREELRNLHFFPPEYGEVNDGTAVDIFSFGMCALEMA
VLEIQANGDTRVTEEAIARARHSLSDPNMREFILSCLARDPARRPSAHNLLFHRVLFEVH
SLKLLAAHCFIQHQYLMPENVVEEKTKAMDLHAVLAEMPQPHGPPMQWRYSEVSFLELDK
FLEDVRNGIYPLMNFAAARPLGLPRVLAPPPEEAQKAKTPTPEPFDSETRKVVQMQCNLE
RSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLAAELVHYGFLHEDDRTKLAAFLE
TTFLKYRGTQA
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggcggccccggagccggcgccgaggagaggccgggaacgcgagcgggaggacgagagc
gaggacgagagcgacatcctggaggagagcccgtgtggccgctggcagaagcggcgggag
caggtgaaccaagggaacatgcccgggattcagagcacctttctggccatggacacggaa
gagggggtagaagtggtgtggaacgaactccacttcggggataggaaggcctttgcggcc
catgaggagaagatccagaccatgtttgagcagctggcgctggtggaccaccccaacatc
gtcaagctgcacaagtattggctggatgcctctgaggcccgcgcgagggtcatcttcatc
acagaatacgtgtcgtctggcagcctcaagcagttcctcaaaaagaccaagaagaaccac
aaggccatgaacgcccgggcctggaagcgctggtgtacgcagatcctgtctgcactcagt
tttttgcacgcctgcagtccccccatcatccacggaaacctgaccagcgacacgatcttc
attcagcacaatggcctcatcaagatcggctctgcacttcctgacgatctccggagccct
ataagaactgaacgggaggagctccgaaacctgcactttttcccaccagagtatggcgag
gtcaacgatgggactgctgtggacatcttctcctttgggatgtgtgcactggagatggcg
gtcttggagatccaagccaacggggatacccgagtcacagaagaagctattgctcgggcc
aggcactcgctgagtgaccccaacatgcgggaattcatcctctcctgcctggcccgggac
cctgcccgccgaccctcagcccacaacctcctcttccaccgagtgctctttgaggtgcac
tcgctgaagctgctggcagcccactgtttcatccagcaccagtacctcatgcctgagaat
gtggtagaggaaaagaccaaggccatggacctccatgcagtgttggctgagatgccccag
ccccatggacccccaatgcagtggcggtactcagaggtttccttcttggagctggacaaa
ttcctagaggatgtcaggaatggcatctatccactcatgaatttcgctgctgctcggccc
ttgggacttcctcgtgtgttggccccacccccagaggaggcccaaaaggccaaaactcca
accccagaaccctttgactcggagaccaggaaggtggtccagatgcagtgcaacctggaa
agaagcgaggacaaggctcggtggcaccttactctgcttttggtgcttgaggaccggtta
catcggcagctgacctatgatctgctcccaaccgacagtgcccaggacctcgccgccgaa
ctagtgcactatggcttcctgcacgaggatgaccggacaaagctagcagcctttctggag
accacttttctcaagtaccgtgggacacaagcgtga

DBGET integrated database retrieval system