KEGG   Rattus norvegicus (rat): 680486Help
Entry
680486            CDS       T01003                                 

Gene name
Dazl
Definition
(RefSeq) deleted in azoospermia-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7
Motif
Other DBs
NCBI-GeneID: 680486
NCBI-ProteinID: NP_001102884
RGD: 1591714
Ensembl: ENSRNOG00000023474
UniProt: D4A0P8
Position
9q12
AA seq 281 aa AA seqDB search
MSATTSEAPNSAVSREASTQSSSATTSQGYVLPEGKIMPNTVFVGGIDVRMDETEIRSFF
ARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQNLC
TYHVQPRPLIFNPPPPPQFQSVWSSPNAETYMQPPTMMNPITQYVQAYPPYPSSPVQVIT
GYQLPVYNYQAYTTVNYHCSEVDPGADLLPNECSVHDAAPASGNGPQKKSVDRSIQTVVS
CLFNPENRLRNSLVTQDDYFKDKRVHHFRRSRAVLKSDHLC
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacaacttctgaggctccaaattcagctgtctccagagaggccagcactcag
tcttcatcagcaaccaccagtcaaggatacgttttgccagaaggcaaaatcatgccaaac
actgtttttgttggtggaattgatgttaggatggatgaaaccgaaatcaggagtttcttt
gccagatatggctcagtaaaagaagtgaagataatcactgatcgaactggtgtgtcgaag
ggctatggatttgtctcattttataatgacgtggatgtgcagaagatagtagaatcacag
attaatttccatggcaaaaagctgaaactgggccctgcaatcaggaaacaaaatttatgt
acttatcatgtgcagccacgtcctttgatttttaatcctcctcctccgccacagttccag
agtgtttggagtagtccaaatgctgagacatacatgcagcctccaaccatgatgaatcct
atcactcagtatgttcaggcatatcctccttatccgagttcaccagttcaggtcatcact
ggatatcagctgcctgtttataattatcaggcttatacaactgttaactaccattgcagt
gaagttgatccaggagctgaccttttgcccaatgaatgctcagttcatgatgctgctcca
gcctctggaaatggcccacaaaagaaatctgtggaccgaagcatacagacagtggtctct
tgtctgtttaaccctgagaacagactgagaaactctcttgttactcaagatgactacttc
aaggataaaagagtacatcactttagaagaagtcgggcagtgcttaaatctgatcatctc
tgctaa

DBGET integrated database retrieval system