KEGG   Rattus norvegicus (rat): 680498Help
Entry
680498            CDS       T01003                                 

Definition
(RefSeq) similar to CG31613-PA
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    680498
  09163 Immune disease
   05322 Systemic lupus erythematosus
    680498
  09165 Substance dependence
   05034 Alcoholism
    680498
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680498
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    680498
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    680498
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   680498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 680498
NCBI-ProteinID: XP_017443230
RGD: 1591702
UniProt: Q6LED0
Position
17p11
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtactaagcagaccgctcgcaagtccaccggtggcaaagccccgcggaagcag
ctggccaccaaagctgcccgcaagagcgctccggctaccggcggcgtgaagaagccccac
cgctaccgtcctggcaccgtggctctgcgcgagatccggcgctaccagaagtcgacagag
ctgctgatccgcaagctgcctttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacttgcgcttccagagctcggcggtcatggccctgcaggaggcctgtgaggcctac
cttgtgggtctatttgaggacaccaacctgtgcgccatccacgccaagcgtgtgaccatc
atgcccaaggacatccagcttgcccggcgcatccggggtgagagggcgtag

DBGET integrated database retrieval system