KEGG   Rattus norvegicus (rat): 680515Help
Entry
680515            CDS       T01003                                 

Gene name
Ckap2l
Definition
(RefSeq) cytoskeleton associated protein 2-like
  KO
K16769  cytoskeleton-associated protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680515 (Ckap2l)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    680515 (Ckap2l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CKAP2_C MOZART1
Motif
Other DBs
NCBI-GeneID: 680515
NCBI-ProteinID: XP_001057508
RGD: 1590645
Ensembl: ENSRNOG00000026143
UniProt: D3Z8Z9
Position
3q36
AA seq 744 aa AA seqDB search
MVGPGPAASAAAEERWQKLQEYLAAKGKLKDPNTKPYLKAKNICPKPPSSKYTPGPKKDV
SNHVVLPGKTTKPINIKLQAKPANITGSQKPESMPPKLPSKGLTPRCFPSNSDYKQSSKP
QQQHKTVPSTAGLSRKPRQSPDTQELKAKQQQEARGTAKCTDPVADTHAEKQSLDGFLDE
TNKENLPRTLLKPKKPDSDLHSIRKPKTGSSNQTQRSLAPKQISSKSSVTHTALKDRANT
QLIRNTQTRAQPGKSQRLPTADSSRPRGKPSQTAPSYSVSAHYKTQTLKKPVIKNTQDIM
VNRVRSGRPNETKVQPCPATEQRVKHTKPSSHLSVLQGGHNSRHLNMQQDQKPVQPCLGP
RTSCILQKSRAISQRPNLMTGDFNSVIPSTPNIRANKTLNSKYSSTFQQKAQTVDSKFKR
FPPQSHFLNKTAPRTQASTTAASRKGAPSVTQTHPHVKKPEGEDRRKQLEEWQKSKGKTY
KRPPMIFKTRRKVIEEMNTSFWKSIEREEEEKTAQLELSRKINSTLTECLRLIEEGVLPN
EIFTVVSSIPEAEKFAKFWVCKAKLLASKGPFDALGLYEEAIQNGAAPIQELQEVLNILQ
DTSRSAEAVTSDSSAAGTNTTSAEELAKEDDSEQPCPPLIERERAPAAPRIPMVEWDNPG
IKLQVAPIPRICGMPEVQDMKLITPVRRSARIERTLASYPEMLQERDIVVASLNELLEVD
NTECFVFRENEALPVTLGFEILES
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggtggggcccggccccgctgccagcgcagccgcggaagaacggtggcaaaagctccag
gagtacctagcagccaagggaaagctgaaggaccccaacaccaagccttatctaaaagcc
aagaatatctgccctaaaccaccatcttctaaatatactcctggacctaaaaaagatgtt
tccaatcatgttgttttgcctggcaaaactacaaaacccatcaacattaaactccaggct
aaaccagccaatatcacagggtcccagaagccagagtcgatgccaccaaaacttccaagc
aaagggctcacgccaagatgttttccttctaactcagactataagcagtccagcaagcct
cagcagcaacataaaactgtgccatccactgcaggactgtcaagaaaacccaggcagtcc
cctgatacacaggaattaaaagccaaacagcaacaggaagctcgaggaacagctaagtgt
acagatcctgtggctgacacccatgctgaaaagcaatctttggatggctttctagatgaa
acgaacaaagaaaacttgccccgaaccttgctaaaacctaaaaagccagattctgactta
cattctataagaaagccaaaaactggctcttctaatcaaactcagagaagtctggctcct
aaacagatctcaagcaaaagttcagttactcatactgctctgaaagacagagccaacaca
cagctcattagaaacacacaaaccagagctcagccggggaagtctcagcgactccctaca
gcagattcatcgcgaccaagaggaaaaccctcacaaacagctccctcttactccgtttca
gcccattataagactcaaacattgaagaaaccagtgatcaagaacacacaggatataatg
gttaacagggttagatctggaagaccaaatgaaactaaggtacagccttgccctgctact
gaacaaagagtaaaacatactaaacctagttcccacctcagtgtgcttcagggaggacat
aacagtaggcatctcaacatgcagcaggatcagaagcctgtgcagccttgtcttggaccc
cggacatcatgcattctgcaaaaatcaagagccataagccagaggcctaatttgatgact
ggcgactttaactcagtcattccaagcacacctaacataagagcaaataaaacacttaac
agtaagtacagtagcacgtttcaacagaaagcacagacagtggactccaagttcaaaagg
tttcctccccagagccattttctgaacaagactgctcccaggactcaagccagtaccaca
gccgcaagtaggaagggagccccgagcgtgacccagactcacccacatgttaaaaaacca
gaaggagaggatcggaggaaacagctggaagaatggcagaaatctaaagggaaaacctat
aaacggcctcccatgatatttaaaacaagaagaaaagtcatagaggaaatgaacacctcc
ttctggaagagcattgaaagagaagaagaagagaagacagctcagctggagctgtccagg
aaaatcaacagcactctgacagagtgtctgaggctcattgaagagggtgtacttcctaat
gaaatatttaccgtagtgtccagcattcctgaggctgaaaaatttgccaagttctgggtg
tgcaaagcaaagttactggcaagtaaaggccccttcgatgctcttggactgtatgaagag
gccattcagaacggggcagcaccaatacaggagctgcaggaagttctgaacattctgcaa
gacacaagcagaagcgcagaagcagtcacctctgacagctcagctgcgggaaccaatacc
acatctgcggaagagctggccaaggaggacgactctgagcagccttgcccaccgctgata
gaaagggagcgggccccagcagcacctcggatacccatggtggagtgggataaccccggt
atcaaattacaggttgccccgatccctagaatatgcgggatgccagaagtgcaagacatg
aagctcatcactcctgtgaggcgctcggcaaggatcgagcgcacactggcgagctaccca
gaaatgctgcaggagcgtgacatagtcgtggcctctcttaacgagctcctggaagtggac
aacacagagtgctttgtcttccgtgaaaatgaggctctgcctgtgacactgggcttcgaa
atccttgaatcatga

DBGET integrated database retrieval system