KEGG   Rattus norvegicus (rat): 680532Help
Entry
680532            CDS       T01003                                 

Gene name
Sem1, Dss1, Shfm1
Definition
(RefSeq) SEM1, 26S proteasome complex subunit
  KO
K10881  26 proteasome complex subunit DSS1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno03440  Homologous recombination
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    680532 (Sem1)
  09124 Replication and repair
   03440 Homologous recombination
    680532 (Sem1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    680532 (Sem1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    680532 (Sem1)
   03051 Proteasome [BR:rno03051]
    680532 (Sem1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    680532 (Sem1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    680532 (Sem1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     680532 (Sem1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     680532 (Sem1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSS1_SEM1
Motif
Other DBs
NCBI-GeneID: 680532
NCBI-ProteinID: NP_001119562
RGD: 1590628
Ensembl: ENSRNOG00000010420
UniProt: D3ZHW9
Structure
PDB: 

Position
4q21
AA seq 70 aa AA seqDB search
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaagaagcagcctgtcgacttgggtctcctggaagaggacgacgagttcgag
gagtttcccgcggaagactgggccggcttagatgaagatgaagatgcacatgtctgggag
gataattgggatgatgacaatgtagaagacgacttctccaatcagttacgcgctgagctg
gagaagcatggttacaagatggagacttcatag

DBGET integrated database retrieval system