KEGG   Rattus norvegicus (rat): 680537
Entry
680537            CDS       T01003                                 

Gene name
Nsd2, RGD1565590, Whsc1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  [histone H3]-lysine36 N-dimethyltransferase NSD2 [EC:2.1.1.357]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
rno01100  Metabolic pathways
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    680537 (Nsd2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    680537 (Nsd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680537 (Nsd2)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     680537 (Nsd2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     680537 (Nsd2)
SSDB
Motif
Pfam: PWWP SET AWS C5HCH PHD HMG_box HMG_box_2 zf-HC5HC2H_2 zf-HC5HC2H
Other DBs
NCBI-GeneID: 680537
NCBI-ProteinID: NP_001178481
RGD: 1307955
Ensembl: ENSRNOG00000038140
UniProt: D4A9J4
Position
14q21
AA seq 1346 aa
MKQAPEILGSANGKTQNCEVNHECSVFLSKAQLSNSLQEGVMQKFNGHDALPFLPAEKLK
DLTSCVFNGEPGAHDTKLCFETQEVKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFE
SSICGDGAADMSQSEENGQKSDNKTRRNRKRSIKYDSLLEQGLVEAALVSKISSPEDKKI
PVKKESCPNSGRDRDLLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHNHTKLKGQKKSAR
QYHVQFFGDAPERAWIFEKSLVAFEGEEQFEKLCQESAKQAPTKAEKIKLLKPISGRLRA
QWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLRLNPQVAKEAGIATEPLGEMVDSSVAN
EEAAVDPGTMREEDIPVKRRRRAKRSSSAENQEGDPGTEKSTPPKMADAEPKRGVGSPAG
RKRSTGSASRSRKGDSAAQFLVFCQKHRDEVVAEHPDASEEEIEELLGSQWSMLNEKQKA
RYNTKFSLMISAQSEEDSGNTSGKKRTHTKRTDDPPEDVDVEDAPRKRLRTDKHSLRKQR
ETITDKTARTSSYKAIEAASSLKSQAATKNLSDACKPLKKRNRASATASSALGFNKSSSP
SASLTENEVSDNPGDEPSESPYESADETQTEASVSSKKSERGMAAKKEYVCQLCEKTGSL
LLCEGPCCGAFHLACLGLSQRPEGRFTCTECASGIHSCFVCKESKMEVKRCMVNQCGKFY
HEACVKKYPLTVFESRGFRCPLHSCMSCHASNPSNPRPSKGKMMRCVRCPVAYHGGDACL
AAGCSVIASNSIICTGHFTARKGKRHHTHVNVSWCFVCSKGGSLLCCEACPAAFHPDCLS
IEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFP
VFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFNEIKLQREAR
ETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKPTDENPCGSDSECLNRMLMF
ECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDE
EECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDT
RVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTSLSSEEKSK
KAKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKRPFGKWE
CPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFRSTQDGQSYCCEHDLRADSANNTKTE
KPFLDSLKAKGKRKKRRCWRRVTDGK
NT seq 4041 nt   +upstreamnt  +downstreamnt
atgaagcaggcaccagaaatccttggcagtgcaaatggaaagactcagaactgtgaagtg
aatcacgaatgttctgtattcctcagcaaagctcagctttctaacagcctacaggagggg
gtcatgcagaaatttaacgggcatgatgcactcccctttcttccagcagagaagttgaaa
gatcttacttcttgtgtgtttaatggagaacctggtgctcatgatactaagttgtgtttt
gagacccaggaagtaaaaggaattgggacaccacccaatactactcctatcaaaaatggc
tctccagaaattaaactgaaaatcaccaaaacatacatgaatgggaaacctctctttgaa
tcttcaatttgtggtgatggcgctgctgatatgtctcagtcagaagaaaatggacaaaaa
tcggataataagactaggaggaacaggaagaggagcataaaatatgactctttgctggag
cagggccttgtggaagcagctttagtgtccaagatctcaagtcctgaagataaaaagatt
ccagttaagaaggagtcctgtccaaatagtggcagagacagagacctcttgttaaaatac
aacgttggtgatttggtgtggtccaaagtgtcaggttacccttggtggccttgcatggtt
tctgctgatccactccttcacaatcataccaaacttaaaggtcagaaaaaaagtgcacgc
cagtatcatgtacaattctttggtgatgccccagaaagagcttggatatttgagaagagc
cttgttgcttttgaaggagaagaacaatttgaaaaattatgccaagaaagtgccaagcag
gcacccacgaaagctgagaaaatcaagttgttgaaacctatttcagggagattgagagcc
cagtgggaaatgggcattgtccaggctgaggaagctgctagcatgtcagtagaggagcgg
aaagccaagtttactttcctttatgtgggggaccaactgcgcctcaaccctcaagtggct
aaggaggctggcattgctacagaacctttgggagaaatggtggactcttcagtggccaat
gaagaagctgctgtagaccctgggactatgagagaagaggacattcccgtaaagagaagg
cgaagagccaaaaggtctagttctgctgagaaccaggaaggagaccccggcacagaaaag
agtacacctccaaagatggcggatgctgaacctaagagaggcgtaggttctcctgccggg
aggaaaaggtccacaggatctgcctcacggagcagaaagggagactcagcagcccagttc
ttagtcttttgtcaaaaacacagggatgaggtcgtagctgaacacccagatgcctcagag
gaggagattgaagaattgcttgggtcccaatggagcatgctcaatgaaaagcagaaagca
cgatataatacaaagttttccctaatgatctctgcccagtctgaagaagactctggaaat
accagtgggaaaaaaaggacccacacaaaaaggacagatgaccctcctgaggatgtggat
gtagaagacgcacccaggaaaagacttaggacagataagcacagtcttcggaagcaaaga
gagacaatcaccgacaaaacggccagaacgagctcgtacaaggctatagaggcagcctcc
tcactcaagagccaggcagcaacgaaaaatttgtctgatgcttgcaaaccactgaagaag
cgaaatcgggcttctgcaacagcgtcttcagcacttgggtttaacaaaagttcatctcct
tctgcatccttaactgagaatgaggtctcagacaacccaggagatgaaccgtcagagtct
ccgtatgaaagtgcagatgaaacacagactgaagcgtccgtctcatctaagaaatctgaa
agaggaatggctgccaaaaaggagtacgtgtgtcagctgtgtgagaagacaggcagtctc
ttactgtgtgaaggcccctgttgtggagcattccacttagcctgccttggactttcccag
agaccagaaggaagattcacctgcactgaatgtgcctcagggattcactcatgcttcgta
tgtaaagaaagcaagatggaggtgaaacgctgtatggtaaaccaatgtggaaagttttac
catgaagcctgtgtgaaaaaataccctctcactgtgtttgagagccgaggctttcgctgt
cctctccacagctgtatgagctgccatgcctcaaacccttcaaatccgcggccatcaaaa
ggtaaaatgatgcggtgcgtccgatgccctgtcgcctatcatggcggggatgcctgcctg
gcagcgggatgttccgtgattgcttctaacagcataatctgcacaggccacttcactgcc
cgcaaggggaagcggcaccacactcatgtcaatgtgagctggtgcttcgtgtgctccaaa
gggggaagccttctgtgctgcgaggcctgtccggcagccttccaccctgattgtttgagc
atcgagatgcctgatggcagctggttctgcaatgactgccgagctgggaagaagctccac
tttcaagacatcatttgggtcaaacttgggaactacagatggtggccagcagaagtttgc
catcccaaaaatgttcccccaaatattcagaaaatgaagcacgagattggagaattccct
gtgtttttcttcgggtctaaagattattactggacgcatcaggcacgagtgttcccatac
atggagggggaccggggcagccgctaccagggggtcagagggattggaagagtcttcaag
aacgcattgcaagaagccgaagctcgttttaatgaaatcaaacttcagcgggaagcccga
gaaacacaggagagtgagagaaagcctccaccatacaagcatatcaaggtgaataaacct
tatggtaaagtccagatctatacagctgacatttctgaaatcccaaaatgcaactgtaag
cccacggatgagaacccctgtggctctgattcagagtgtctaaacaggatgctaatgttt
gagtgccacccgcaggtgtgccctgcaggggaatattgccagaaccagtgtttcactaag
cgccagtacccggagaccaagatcatcaagaccgatggcaaagggtggggcctggttgcc
aaaagggacatcagaaagggagaatttgttaatgagtatgttggcgaactgattgatgaa
gaggagtgtatggcaagaatcaaatatgcacatgagaatgacatcactcacttttacatg
ctcaccatagacaaggaccgcataattgatgctggccccaaagggaattactcgcggttc
atgaaccatagctgccagcccaactgtgagaccctgaagtggacagtgaatggggacaca
cgggttggcctgtttgctgtgtgcgacatccctgcaggtacagagctgactttcaactat
aacctcgattgtttgggcaatgaaaagacagtctgtcggtgtggagcctccaactgtagt
gggttccttggagacagaccaaagacatcaacatccctttcttcagaggaaaagagtaaa
aaggccaagaagaaaaccaggaggcgcagagccaagggtgaaggaaagcggcagtcagag
gacgaatgcttccgctgtggtgatggcggacaactggtgctgtgtgaccgcaagttctgc
accaaggcctaccacctatcctgcttgggcttgggcaagcggccctttgggaagtgggaa
tgtccttggcatcactgtgatgtgtgtggcaaaccttctacctcattttgccacctctgc
cccaactcattctgtaaggaacaccaagatgggactgctttccgctccacccaggatggg
caatcctactgctgtgagcatgacctgagggcagactctgcaaataataccaagactgag
aaaccctttctagactcactcaaggcgaaggggaagaggaagaaaaggcggtgctggcga
agggtcacagacggcaaatag

DBGET integrated database retrieval system