KEGG   Rattus norvegicus (rat): 680678
Entry
680678            CDS       T01003                                 

Gene name
Tcf24
Definition
(RefSeq) transcription factor 24
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 680678
NCBI-ProteinID: XP_008761741
RGD: 1589398
Ensembl: ENSRNOG00000052668
UniProt: A0A0G2JWM6
Position
5q11
AA seq 170 aa
MERGRPSSSPRSAEPAPPAAAAAAAARDSSPGQPGAGPTGPGGVAARSGSGRPAAANAAR
ERSRVQTLRHAFLELQRTLPSVPPDTKLSKLDVLLLATTYIAHLTRSLQDDTDAPGDPSL
GALRGDGYLHPVKKWPMRSRLYIGATGQFLKHSVPGEKGSHNDAPAASPP
NT seq 513 nt   +upstreamnt  +downstreamnt
atggagcgcggccgtccctccagcagtccacgcagcgccgagcccgccccaccggccgcc
gccgccgccgccgccgcccgcgactcgagcccagggcagcccggagccgggccgacaggc
cccggcggggtcgcggcgcgctccgggagtggccgtccagcggctgcgaacgccgcgcgg
gagcgcagccgcgtgcaaaccctgaggcacgccttcctggagctgcagcgcacgctgccg
tcggtgccgccggacaccaagctgtccaagttggacgtgctgctgctggccaccacctac
atcgcccacctcacccgcagcctgcaggacgacaccgacgcgccgggagaccccagtctg
ggcgccttgcgaggtgacggctatctgcacccagttaagaagtggcccatgcgatcaaga
ctgtatatcggtgcaactggtcagtttctgaagcattctgtccctggagaaaagggaagc
cacaacgatgctccagccgcctccccgccgtag

DBGET integrated database retrieval system