KEGG   Rattus norvegicus (rat): 680712Help
Entry
680712            CDS       T01003                                 

Gene name
Scx
Definition
(RefSeq) scleraxis bHLH transcription factor
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 680712
NCBI-ProteinID: NP_001123980
RGD: 1588254
Ensembl: ENSRNOG00000021812
UniProt: G3V8X3
Position
7q34
AA seq 209 aa AA seqDB search
MSFAMLRSAPPPGRYLYPEVSPLSEDEDRGSESSGSDEKPCRVHAARCGLQGARRRAGGR
RAAGSGPGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETL
RLASSYISHLGNVLLVGEACGDGQPCHSGPAFFHSGRAGSPLPPPPPPPPLPLARDGGEN
TQPKQICTFCLSNQRKLSKDRDRKTAIRS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgccatgctgcgttcagcgccaccgccgggccgctacctgtaccctgaggtg
agcccgctgtccgaggatgaggaccgcggaagcgagagctcgggctccgacgaaaaaccc
tgtcgtgttcatgctgcgcgctgcggcctccagggcgcccggcggcgggcaggaggacgg
agggccgcgggtagtgggccaggacccggggggcggccaggccgcgagccccggcagcgg
cacacagcgaatgcgcgcgagcgggaccgcaccaacagcgtgaacacggccttcactgcg
ctgcgcacactcatcccgaccgagccagcagatcgcaagctctccaagattgagacgctg
cgcctggcctccagctacatttctcacctgggcaacgtgctactggtgggtgaagcctgc
ggtgacgggcagccctgccactcgggacccgctttcttccacagcggtcgtgcgggcagc
ccactaccaccgccaccgccgccgcccccactaccactggccagagacggcggcgagaac
acccagcccaaacagatctgcaccttctgcctcagcaaccagagaaagttgagcaaagac
cgtgacagaaagacggcgattcgaagttag

DBGET integrated database retrieval system