KEGG   Rattus norvegicus (rat): 680717Help
Entry
680717            CDS       T01003                                 

Gene name
Zfp703, Znf703
Definition
(RefSeq) zinc finger protein 703
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: nlz1 zf-C2H2 zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 680717
NCBI-ProteinID: NP_001102895
RGD: 1588249
Ensembl: ENSRNOG00000014199
UniProt: D4ABF5
Position
16q12.3
AA seq 593 aa AA seqDB search
MSDSPAGSNPRTPESSGSGGSGGGGKRPAVPAVVSLLPPADPLRQANRLPIRVLKMLSAH
TGHLLHPEYLQPLSSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNSVAAAAAN
GLGSEKDPSRSAPGAASAAAALKQLGDSPAEDKSSFKPYSKGSGGGDSRKDGGSSSVSST
TSSSSSSPGDKAGFRVPSAACPPFPPHGAAVSTSSNSSSPGGSRGGSPHHSDCKSGSGGA
GGGGELDKKDQEAKPSPEPAAGSRGSSGDSAHGGPEATASGRKSEPPSALVGAGHVAPVS
PYKPGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKP
PSSSPLTGASPPSFLQGLCRDPYCLGGYHSASHLGGSSCSTCSAHDPAGPSLKASGYPLV
YPGHPLQPAALSSSAAQAALPGHPLYTYGFMLQNEPLPHSCNWVAASGPCDKRFATSEEL
LSHLRTHTALPGAEKLLAAYPGASSLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRSP
HTLGLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattcgcccgctggatctaacccaaggacacccgaaagcagcggcagcggcggc
agcggcggcggcgggaagaggccggcggtgccggcagtggtgtccctcctgcccccggcg
gaccccctgcgccaggcgaaccggctccctatcagggtcctgaagatgctgagcgctcac
accggtcacctcctgcacccggagtacctgcaaccgctgtcctccactcccgtcagcccc
attgagctggacgccaagaagagtcctttggctctgctagcccagacctgctcgcagatc
ggcaagcccgacccgccgccctcgtccaagctcaactccgtggcggcggcggcggccaac
gggctgggatccgagaaagacccgagccgctccgcccccggcgccgcctctgcggccgcg
gcgctcaagcagctgggggactccccggcggaggacaagtccagcttcaagccctactct
aagggctccggcggcggcgactcccgcaaagacggcggctcctcgtcggtgtcctccacc
acctcttcgtcctcctcatccccgggagacaaggctggcttcagggtccccagcgccgcc
tgccctccctttcccccgcatggagcagcggtctccacctcgtcaaactcgtcttcgccg
ggcggctcccgcggaggttccccacaccactcagactgcaagagcggcagcggcggggcc
ggcggcggcggggaactggacaagaaagaccaggaagccaaacccagtcccgagccagcc
gctggaagccgaggcagcagcggggactcggctcacggtggcccggaggccaccgcatca
gggcgcaaatccgaaccgccctccgccctggtgggggcgggccacgtggccccagtgtca
ccctacaaaccaggccactcggtgtttccactaccgccctccagcatcggttatcacggc
tccattgtgggcgcctacgccggctacccgtctcagttcgtgcctggcctggatcctagc
aagtctggtttagtgggaggtcagctgtccgggggcctgggcctgccacccggcaagccc
cccagctccagcccgctcaccggggcctccccaccctccttcctgcagggattatgccgt
gacccctactgcctaggaggctaccacagcgcctcgcacctcggtggctctagctgctcc
acttgcagcgcgcacgatccggccgggcccagccttaaggccagtggctaccctctggtg
taccccgggcaccccttgcaacctgcggcgctctcctccagcgccgcccaggccgcgctc
ccgggccatcctctctacacctatggcttcatgctgcagaatgaaccgctgccacacagc
tgcaattgggtggcggccagcgggccctgcgacaagcgctttgccacttccgaggagctg
ctcagccatctacggactcacacagccctgccgggcgcagagaaacttctggccgcctac
ccgggggcctcgagcttgggcagtgccgcagcagccgctgcagccgcggcctcttgtcat
ctgcatctccccccgcccgccgccccaggcagccccggatcgctgtcattgaggagtcca
cacactttggggctaagccggtaccacccctatggcaagagccacttatctacagctggg
ggcctggcagtgccgtcccttcccacagccggaccctactactcgccatatgcactgtat
ggacagaggctagcttccgcctcggcgcttggataccagtaa

DBGET integrated database retrieval system