KEGG   Rattus norvegicus (rat): 680910Help
Entry
680910            CDS       T01003                                 

Definition
(RefSeq) similar to paired immunoglobin-like type 2 receptor beta
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3
Motif
Other DBs
NCBI-GeneID: 680910
NCBI-ProteinID: XP_006249112
RGD: 1585879
Ensembl: ENSRNOG00000048881
UniProt: M0RCW7
Position
12q11
AA seq 211 aa AA seqDB search
MARLLLLLLSASYLHTGNSAGYQKKKDFGVDQPDVLSGVQGGSIEIPFSFYFPWKLAKDP
QMSIAWRWKHFHGEFIYNSTRPFLHEHFKGRLIMIWTQGQTSGVLRILNLKDNDQTTYFC
RVILQTTEGMNSLQSISGTNLIIHALNTTMGSPSIIPSAVPTAGLEDKRDQRNPSLLNLG
AMVGMVLAKVVVIIPLYGWMIFLWWKQRPAA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctcggcttctccttcttttgttgtcggcatcatatctgcacactgggaactcagca
ggatatcaaaaaaagaaagactttggtgtcgaccaaccagatgtcctctctggagtccaa
ggtggctccatcgagatccccttttccttctacttcccctggaagttggccaaggatcct
cagatgagcatagcctggagatggaagcacttccatggggaattcatctataactccacc
cggcctttccttcatgagcattttaagggccggctcatcatgatttggacacagggtcag
acatctggtgtcctcagaatcctgaacttgaaggacaatgatcagaccacatacttctgt
cgagttattctgcaaacaacagaaggcatgaattcgttgcagtcaatctctggcaccaat
ctcatcattcatgctctcaatactaccatggggagcccctctatcatcccctctgcagtc
cccacagctggcctggaggacaaaagggaccagaggaatccttcactgctgaacctggga
gccatggttgggatggtcttggccaaagttgtggtcatcatccccctgtatggatggatg
atcttcctgtggtggaagcaaaggccagcagcataa

DBGET integrated database retrieval system