KEGG   Rattus norvegicus (rat): 680945Help
Entry
680945            CDS       T01003                                 

Gene name
Sdf2l1
Definition
(RefSeq) stromal cell-derived factor 2-like 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MIR
Motif
Other DBs
NCBI-GeneID: 680945
NCBI-ProteinID: NP_001102903
RGD: 1585844
Ensembl: ENSRNOG00000001859
UniProt: D4A9Y0
Position
11q23
AA seq 220 aa AA seqDB search
MLGASRGLAGLTLLGLLLALSVRSGGASKASAGLVTCGSVLKLLNTHHRVRLHSHDIKYG
SGSGQQSVTGVEASDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFP
SPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNP
IRGQHEVHGMPSANAHNTWKAMEGIFIKPGADPSTGHDEL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcgcgagccgcgggttagcgggtctgacgctgctggggctgctgctggcgctc
tcggtgcggagcggtggcgcgtcgaaggccagcgccgggctagtgacctgcgggtcagtg
ctgaagctactcaacacccaccacagagtgcggctgcactcacatgacatcaaatacgga
tccggcagcggccaacagtcggtaaccggcgtggaggcgtccgacgatgccaatagttac
tggcggattcgcggcggctccgagggtgggtgcccgcgcgggctcccagtgcgctgtggg
caggcagtgcggctcacgcacgtgctcaccggcaagaacctgcacacgcaccacttcccg
tcaccgctatccaacaaccaggaggtgagtgcttttggggaagacggtgagggtgatgac
ctggacctgtggacagtacgatgttctgggcaacactgggagcgagaggccagtgtccgt
ttccagcatgttggcacctctgtgttcctgtcagttactggtgaacagtatggtaaccca
atccgtgggcagcatgaggtgcatggcatgcctagtgccaatgcacacaacacgtggaag
gccatggaaggaatcttcatcaagcccggagcagatccctccacaggtcacgatgaactc
tga

DBGET integrated database retrieval system