KEGG   Rattus norvegicus (rat): 681012
Entry
681012            CDS       T01003                                 

Gene name
Smg5
Definition
(RefSeq) SMG5 nonsense mediated mRNA decay factor
  KO
K11125  protein SMG5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    681012 (Smg5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    681012 (Smg5)
   03032 DNA replication proteins [BR:rno03032]
    681012 (Smg5)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance  factors
     681012 (Smg5)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     681012 (Smg5)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    681012 (Smg5)
SSDB
Motif
Pfam: EST1_DNA_bind EST1 PIN_4
Other DBs
NCBI-GeneID: 681012
NCBI-ProteinID: XP_001059906
RGD: 1584731
Ensembl: ENSRNOG00000019590
Vega: OTTRNOG00000002059
UniProt: E9PU03
Position
2q34
AA seq 1017 aa
MSQGPPPVESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKPENVSLRNKLR
ELCVKLMFLHPVDYGRKAEELLWRKVYYEVIQLIKTNKKHIHSRSTLECAYRTHLVAGIG
FYQHLLLYIQSHYQLELQCCIDWTHVTDPLIGCKKPVSASGKEMDWAQMACHRCLVYLGD
LSRYQNELAGVDTELLAERFYYQALSVAPQIGMPFNQLGTLAGSKYYSVEAMYCYLRCIQ
SEVSFEGAYGNLKRLYDKAAKMYHQLKKSETRKLSPSKKRCKDIKRLLVNFMYLQSLLQP
KSSSVDSELTSLCQSVLEDFNLCLFYLPSSPSLGLTNEDEEECESGYAFLPDLLIFQMAI
ICLMGVHSLKRAGSKQYSAAIAFTLALFSHLINHVNIRLQAELEEGENPVSAFQSDGTDE
PESKEALEKEEPEPEPPTVVPQADEGRKSRKHSRLSCLRRRRRHHPPKAGDDSDLSEGFE
SDSSHDSAQASDGSDSGSDKSLEGRGTAFDAETDSEMNSQESRSDLEDIEDEEGTRSPAQ
EPPQTRSEVPDSLNGPLGPSEASIASNLQAMSTQMFQTKRCFRLAPTFSNLLLQPTAEPN
SVASHRPCVNGDMEKPLEPASEDGSESEGSESSSRSCRNERSLQEKLQALMAEGLLPAVK
VFLDWLRTNPDLIIVCAQSSQSLWNRLSVLLNLLPASGELQDSGLALCSEVQGLLEGCEL
PDLPASLLLPEDMALRNLPPLRAAHRRFNFDADRPLLSALEESVVRICYIRSFGHFVARL
QGSILQFNPEVGIFVSIAQSEQESLLQQAQAQFRMAEEEARRNRLMRDMAQLRLQLEVSQ
LEGSLQQPKAQSAMSPYLIPDTQALCYHLPVIRQLATSGRFIIIIPRTVIDGLDLLKKEQ
PGARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCRQLTLAQ
GAGEEDPSGMVTIITGLHLDNPSALSGPMQAALQAAAHASVDVKNVLDFYRQWKEIG
NT seq 3054 nt   +upstreamnt  +downstreamnt
atgagccaaggccctcctccagtggagagcagcgaacctgaagcaaaggtcctccacacc
aagcggctttaccgggctgtggtggaggctgtgcatcggctagacctcatcctttgcaac
aaaactgcttatcaggaagtgtttaaaccagagaacgttagcctgaggaacaagctgcgt
gagctctgtgtgaagcttatgttcttgcacccagtagactatgggaggaaggctgaggaa
ctgctgtggagaaaggtatactatgaagtcatccaactcatcaagactaacaaaaagcac
atccacagtcggagcaccttggaatgtgcctacaggactcacctggtcgccggcattggc
ttctaccagcatctccttctctatatccaatcccactaccagctggaactacagtgctgc
attgactggactcatgtcactgatcccctcataggatgtaagaagccagtatctgcttca
ggaaaggagatggattgggcacagatggcatgccaccgatgtctggtgtacctgggggat
ctgtcacgctatcagaatgaactggctggtgtggacactgagctgctagctgagagattc
tactatcaagccttgtcagtcgcgccccagattggaatgcccttcaaccagctgggcact
cttgcaggcagcaagtattacagtgtggaagccatgtactgttacttgcgctgcatccag
tcggaagtgtcctttgagggagcctatgggaacctcaagagactctatgacaaggcagca
aaaatgtaccaccagttgaagaagtctgagaccaggaagctctcccctagcaaaaagcga
tgcaaagacattaagaggttgttggtgaacttcatgtacctacaaagcctgttacagccc
aaaagtagctctgtggactcagaactgacctcactttgccagtcagtcctagaggatttc
aacctctgcctcttctacctgccctcctcacccagccttggtctgacgaacgaggatgag
gaggagtgtgagagtggatatgctttcctgcccgacctgctcatctttcagatggccatc
atctgccttatgggtgtgcacagtttaaaaagagcaggatccaagcagtatagtgcagcc
attgctttcaccctggccctcttctcccaccttattaatcatgtcaacatacgactgcag
gcagagctggaagagggcgagaaccctgtctcagcttttcagagtgatggcacagatgaa
ccagagtcaaaagaagcactagaaaaagaggagccagagccagagcctcccactgtggtg
ccccaagccgatgagggtagaaagagtcgtaagcactcccgactctcttgtcttcgtcgc
cgccgccgccaccaccctcctaaggctggtgatgacagtgacctgagtgagggttttgag
tcagactctagccatgactctgcccaggccagtgatggatcagacagtggctctgacaag
agcctggaaggcaggggcactgcttttgatgcagaaacagactcagagatgaacagccag
gagtcccggtcagacctggaagatatagaggatgaagaggggacacggtctccagcccag
gagccccctcagaccagatcagaggttccagattccctcaatggccccttgggccctagt
gaggcaagcattgccagcaatttacaagccatgtccacccagatgttccagaccaagcgc
tgcttccgactggctcccactttcagcaacctgctcctgcagcccaccgcagaacctaac
agtgtggccagtcataggccttgtgtcaacggggatatggagaaacctttagaaccagcc
tctgaggatggctctgagtcagaggggagcgagtccagcagccgttcttgtcgcaacgag
cgcagccttcaggagaagctgcaggccctgatggctgagggcctccttcctgctgtgaag
gtcttcctggactggcttcgaaccaaccctgacctcatcattgtgtgtgcgcagagctct
caaagtttgtggaaccgcctgtctgtgttgctgaatctgttgccagcatctggtgagctc
caggattctggcctggctctgtgttctgaagtccaaggtctccttgaaggctgcgagctg
cctgacctccctgctagcctgttgctcccagaggacatggcactgcgtaacctacctcct
ctccgggctgctcatagacgctttaacttcgatgcagatcggcccctgctcagtgcttta
gaggagtcggtggtgcgcatctgctatatccgcagcttcgggcattttgttgctcgctta
caaggcagcatcctgcagttcaatccagaggttggcatcttcgtcagcattgctcagtct
gagcaggagagcctgctgcagcaggctcaggcacagttccgtatggcagaggaggaagct
cggcggaacaggctcatgagagacatggctcagctacgattacagctcgaggtctcccaa
ctggaagggagcctgcagcagcccaaagcccagtcagccatgtctccctacctcatccct
gacacccaggccctctgctaccacctccctgtcatccgtcagctcgccaccagcggccgc
ttcatcatcatcattccaaggacagtgattgatggtctggatttgctgaagaaagaacag
ccaggggcccgggacgggatccggtacctggaggcagagtttaaaaagggaaacagatac
attcgctgccagaaggaggtgggaaagagctttgagcggcataagctgaagcggcaggat
gcagatgcctggactctctataagatcctggacagctgcagacagctaaccctagcccag
ggggcaggggaggaggacccaagtggcatggtgaccattatcacaggccttcatttggac
aaccccagtgcactctctgggcccatgcaggctgccctacaagctgctgcccatgccagt
gtggacgtcaagaatgttctagacttctacaggcagtggaaggagattggttga

DBGET integrated database retrieval system