KEGG   Rattus norvegicus (rat): 681023Help
Entry
681023            CDS       T01003                                 

Gene name
Qsox2
Definition
(RefSeq) quiescin sulfhydryl oxidase 2
  KO
K10758  thiol oxidase [EC:1.8.3.2]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    681023 (Qsox2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     681023 (Qsox2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_SOX QSOX_Trx1 Evr1_Alr Thioredoxin OST3_OST6 eIF-5_eIF-2B Zn-ribbon_8
Motif
Other DBs
NCBI-GeneID: 681023
NCBI-ProteinID: NP_001102904
RGD: 1584720
Ensembl: ENSRNOG00000018574
UniProt: D3ZP13
Position
3p13
AA seq 708 aa AA seqDB search
MAVARVKGQRAGGTPNMAAARAVARGPGADARRPLSPQAARGPRLLLLLAVVAAVGPQEG
GGARLYRVGEDAVWLLDSGSVRSATGNSSAAWLVQFHSSWCGHCIGYAPTWRALAADVRD
WAAAIRVAALDCAEEKNQDVCRTYDIHFYPTFRYFRAFTKEFTTGENFKGPDRELRTVRQ
TMIDFLQNHTEGSRPPACPPLDPIQSSDILSFMDSHSGQYHAVVFESNGSYVGREVILDL
IPYDNIMVSRALDTDKAFLGTLGISSVPSCYLIYPNGSHGLVNVAKPLRSFFSSYLKSLP
DVRKKSLSLPEKPNKEENSEVVIWKEFDRAKLYTADLESGLHYLLRVELAAHRSLAGAQL
KTFKDFVTVIAKLFPGRPPVKKLLETLHEWLANLPLDKIPYNAILDLVNNKMQISGLFLT
SHITWVGCQGSRLELRGYPCSLWKLFHTLTVQASTHPEALVGTGFEGDPQAVLQTMRRYI
RTFFGCKECGEHFEEMAKESMDSVKTADQAVLWLWRKHNMVNSRLAGHLSEDPKFPKVPW
PTPDLCPVCHEEIKGLDSWDEEQVLVFLKQHYSRDNLVDTYSVDQGSPGEWEGMGRRQEE
GKGLNPSGKAWGHQDTESLRPAHILGPRTDLSKSLHHRLDLRLQSPQGPQTLEEAKAVVP
FLGVGFSSLDMSLCVVLYVASSLFLMIMYFFFRVRSKRWKVRLYHPAV
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgctagggtgaaaggtcaacgcgccggcggcactcccaacatggctgccgcc
cgggctgtggcgcgcggtcccggagctgatgcgcggcggccactctctcctcaggcggcg
cgggggccgcggctgctcctgctgctggcggtggtggcggcagtggggccccaggagggc
ggcggggcgcggctgtaccgcgtgggcgaggacgccgtgtggttgctggacagcggcagc
gtgcgttcggccacgggcaacagctcagccgcgtggctggtgcagttccattcgtcgtgg
tgcggccactgcatcggctacgcacccacctggcgagcgctggcggcggacgtgcgagac
tgggctgctgccatccgtgtcgctgctctggactgtgcagaagaaaagaaccaggacgtg
tgccgcacatatgacatccacttctaccccaccttcaggtattttagagcatttacaaag
gagtttacaactggagaaaattttaaaggacctgacagggagctacggacggtcaggcag
acaatgatcgacttcctgcagaaccacactgagggctcccggcctcctgcatgcccaccc
ctggatcctattcagtccagtgacatcctttccttcatggacagccacagtggccagtac
catgctgttgtatttgaaagcaacggttcttatgttggacgagaggtgatcttagatttg
attccatatgacaacatcatggtgagccgagcactggatacggacaaagcatttctgggg
acccttggcatttcgtcagttccttcctgttacttgatttacccaaatgggtctcatggt
ctggttaatgttgcaaagcctctacggtcgtttttctcctcttatttaaaatccttacca
gatgtgaggaaaaagtcactttccttgcctgaaaagcccaacaaagaagaaaattcagag
gttgtgatttggaaagaatttgacagggccaagctatacaccgcagacctggagtcggga
cttcattacctgctgagagtggagctggctgcccacagatccctggccggagcccagtta
aaaacattcaaggacttcgtgactgtcattgccaagctgttccctggccggccaccagtc
aagaagctgttggagaccctgcatgagtggctggccaacctccccctggacaagattcca
tacaatgccatcctagacctagtcaacaacaaaatgcagatttctggactctttcttacc
agccacataacgtgggtaggatgtcaaggaagccgattggagttgaggggctacccgtgc
tccctctggaaactgttccacactttgacggttcaggcctccacccatccagaagcgctg
gttggcacaggctttgaaggtgacccccaggctgtgctgcagaccatgaggagatacatt
cgcacattctttgggtgcaaagaatgtggtgaacattttgaggaaatggctaaggagtcc
atggactccgtgaaaactgcagaccaagctgttctctggctttggaggaagcacaacatg
gtgaacagccgcctggcaggccatttgagtgaggatcctaagtttccaaaggtcccatgg
cccactccagacctctgcccagtctgccatgaggaaattaaaggactagacagctgggat
gaggagcaggtgcttgtgttcctgaagcagcactacagcagggacaacctggtggacaca
tactctgtggaccagggcagtcctggtgagtgggaaggcatgggcagacggcaagaagaa
ggcaaaggtcttaacccctcagggaaggcctggggacaccaggacactgagagtctccgt
ccagcccatattctggggcccagaactgacctttccaagagcctgcaccacaggctggac
ctaagactacagagccctcagggaccccagacccttgaggaggccaaggcagtcgtgccc
ttccttggggttggcttctccagtctggacatgagcctctgtgtggtgctctacgtggcc
tcctccttgttcctgatgatcatgtacttcttcttcagagtaaggtccaagcgatggaaa
gttcggctctaccacccagctgtgtag

DBGET integrated database retrieval system