KEGG   Rattus norvegicus (rat): 681033Help
Entry
681033            CDS       T01003                                 

Gene name
Prss41, RGD1304769, Tessp1
Definition
(RefSeq) protease, serine, 41
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 681033
NCBI-ProteinID: NP_001128559
RGD: 1584711
Ensembl: ENSRNOG00000033690
UniProt: D4ABF2
Position
10q12
AA seq 324 aa AA seqDB search
MGVQGPMLLLLLLVVCVMLGEPGSREENQAAGLKNTDIKLLSMPCGRRNDIRSRIVGGIE
SVRGRWPWQASLRLRKFHRCGGSLLSHRWVLTAAHCFRKFLDPKKWTVQLGQLTSKPSFW
NREAFSGRYRVKDIIINSEDKLKYHDLALLRLASSVTYNKFIQPVCVLPSASMSQHQPRC
WVTGWGALQEDLKPLPPPYHLREVQVTVLNLSRCQELFSFASRYHLITRDVFCAGAEDGS
ADTCSGDSGGPLVCNMDGLWYQIGIVSRGVGCGRPKLPGIYTNVSHHYDWIKTMMILNGA
VRHDLALPLLFFTPLQAPWLLRPT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtacagggcccaatgctgctactgctgctgctggtggtgtgcgtgatgctgggg
gagcctggatcgcgtgaagaaaaccaggcggcaggcctcaagaatacagacatcaagctt
ctctcaatgccgtgtggccgccggaatgacattcggtcccggatagtgggcgggatagaa
tccgtgcgagggcgctggccgtggcaggccagcctgcgtttgaggaagttccaccgctgc
ggagggagccttctcagccaccgatgggtgcttactgctgcacactgctttagaaagttc
cttgatccaaaaaagtggacggtccagcttgggcagctgacctccaagccttctttctgg
aacagggaggccttctctggccggtacagggtaaaggacatcatcataaactccgaagac
aaactgaagtaccatgacctcgccctgctgaggctggcctcctcggtcacctacaacaag
ttcatccagcctgtctgtgtgctgccttccgcctccatgtcccagcaccagccccggtgc
tgggtgaccggctggggagccctccaggaggatttgaagcccctgccaccgccctatcac
ctccgagaagtacaggttaccgtcctaaacctcagcagatgccaggaactcttcagcttt
gcctcccgataccacttgatcaccagggatgtgttctgtgccggtgcggaggatgggagc
gccgacacctgcagtggtgactcaggaggacctttggtctgcaacatggatggtctgtgg
tatcagattggaatcgtgagccggggagtaggctgtgggcggcccaaactgcctggcatc
tacaccaacgtcagccatcactacgactggattaagaccatgatgatcctcaatggtgca
gtcaggcatgacctggccctgccattgctgttcttcactccactccaggctccctggctc
ctgaggcccacctga

DBGET integrated database retrieval system