KEGG   Rattus norvegicus (rat): 681059Help
Entry
681059            CDS       T01003                                 

Gene name
Vps25
Definition
(RefSeq) vacuolar protein sorting 25
  KO
K12189  ESCRT-II complex subunit VPS25
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    681059 (Vps25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    681059 (Vps25)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    681059 (Vps25)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-II complex
    681059 (Vps25)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   681059 (Vps25)
  Exosomal proteins of colorectal cancer cells
   681059 (Vps25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ESCRT-II
Motif
Other DBs
NCBI-GeneID: 681059
NCBI-ProteinID: NP_001166922
RGD: 1584685
Ensembl: ENSRNOG00000051179
Vega: OTTRNOG00000000805
UniProt: P0C0A1
Position
10q31
AA seq 176 aa AA seqDB search
MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLF
NNVKLQRKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQ
NNSVFTLYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgagtttcgagtggccgtggcagtaccgcttcccgcccttctttacgttacag
ccgaacgtggacacccggcagaagcagctggccgcctggtgctctctggttctgtccttc
tgccgcctgcacaaacagtccagcatgacggtgatggaagcccaggagagcccgctcttc
aacaacgtcaagctacagcggaaacttcctgtggagtcgattcagattgtattagaagaa
ctgaggaagaaagggaacctcgagtggttggataagaataagtctagcttcctgatcatg
tggcggaggccagaagaatgggggaaactcatttatcaatgggtttccaggagtggccag
aataactctgtgttcaccctgtatgaactgaccagtggggaagacacagaggaggaagag
ttccatgggctggatgaggcgaccctgctgcgtgctctgcaggccctacagcaggagcac
aaggctgagattatcactgtcagcgatggccgaggagtcaaattcttctag

DBGET integrated database retrieval system