KEGG   Rattus norvegicus (rat): 681190Help
Entry
681190            CDS       T01003                                 

Gene name
Kcne5, Kcne1l
Definition
(RefSeq) potassium voltage-gated channel subfamily E regulatory subunit 5
  KO
K04895  potassium voltage-gated channel Isk-related subfamily E member 1-like
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    681190 (Kcne5)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   681190 (Kcne5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ISK_Channel
Motif
Other DBs
NCBI-GeneID: 681190
NCBI-ProteinID: NP_001094473
RGD: 1583501
Ensembl: ENSRNOG00000019176
UniProt: A5HKJ1
Position
Xq33
AA seq 143 aa AA seqDB search
MNCSESQRLQTLLNRLLLELHHRGNASGLGVGSGPSMGMGVVPDPFVGREATSAKGNDAY
LYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPPLACVAEQEWVPTAVASADPENGQGL
LGEGSHQLAPGALPALAQCAERV
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaactgcagcgagagccaacggctgcaaaccctcttgaaccgcttgctgctggagctg
catcatcgtggcaacgccagcggcctcggtgtcggatccggcccgagcatgggcatgggg
gtcgtccctgaccctttcgtgggccgtgaggcgaccagcgccaagggtaacgatgcttat
ctctacatcctactcatcatgatcttctatgcttgcctagccggaggcctcatcctggcc
tacactcgctcccgcaagctcgtcgaggccaaggatgagccacccctggcctgtgttgcc
gagcaggaatgggtccccaccgccgtcgcatctgctgacccggagaatggccagggcttg
ctgggtgagggcagccaccagctcgcaccaggggctctgcctgcattggcccagtgcgct
gagagggtctag

DBGET integrated database retrieval system