KEGG   Rattus norvegicus (rat): 681219Help
Entry
681219            CDS       T01003                                 

Gene name
Cox14, C12orf62
Definition
(RefSeq) COX14, cytochrome c oxidase assembly factor
  KO
K18181  cytochrome c oxidase assembly factor 14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    681219 (Cox14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    681219 (Cox14)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    681219 (Cox14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX14
Motif
Other DBs
NCBI-GeneID: 681219
NCBI-ProteinID: XP_001060794
RGD: 1598052
Ensembl: ENSRNOG00000061425
UniProt: Q5XFV8
Position
7q36
AA seq 57 aa AA seqDB search
MPSAKQLADIGYKTFSASMMLLTVYGGYLCSVRAYHYLQLRSARRQAAEEQKTSGVL
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgccaagcagctagccgacattggctacaagaccttctctgcctcgatgatg
ctcctcactgtgtacgggggctacctctgcagcgtacgagcctaccattacctccagctg
cgcagtgccaggcgccaggccgcggaagagcagaagacctcaggagtcctgtag

DBGET integrated database retrieval system