KEGG   Rattus norvegicus (rat): 681236Help
Entry
681236            CDS       T01003                                 

Gene name
Cd79al, Cd79a
Definition
(RefSeq) Cd79a molecule-like
  KO
K06506  CD79A antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04662  B cell receptor signaling pathway
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    681236 (Cd79al)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    681236 (Cd79al)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    681236 (Cd79al)
CD molecules [BR:rno04090]
 Proteins
  681236 (Cd79al)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 ig V-set Ig_2 I-set
Motif
Other DBs
NCBI-GeneID: 681236
NCBI-ProteinID: XP_001060872
RGD: 1598036
Ensembl: ENSRNOG00000049925
UniProt: M0R9P4
Position
9q12
AA seq 123 aa AA seqDB search
MLGGLGVLRTLPLLLLFLSEACLGPGCQALMLERDPPSLTVNLGEEAVLTCKNDGKNPNI
TWWFSLQSNSTWPPMPLGPGLGPMGKLIFPEVNKSHRGLYWCQVIESKEVKRSCGTYLRV
RSE
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgctagggggtctaggagtcctccgaaccctgcctctcctcctcctcttcctgtccgaa
gcctgcctgggtcctggatgccaggccctgatgttagaaagggatccaccatccctgacg
gtgaacttgggtgaggaggccgtcctcacctgtaagaacgacggcaagaaccctaatatc
acatggtggttcagtctccagtccaacagcacatggcccccaatgccactgggtcctggc
ctgggtcccatgggcaagctgatcttccccgaagttaacaagagccacaggggcttgtac
tggtgccaagtgatagagagcaaagaagtaaagcgttcctgtggcacttacctccgagtg
cgcagtgagtag

DBGET integrated database retrieval system