KEGG   Rattus norvegicus (rat): 681249Help
Entry
681249            CDS       T01003                                 

Gene name
Fam72a
Definition
(RefSeq) family with sequence similarity 72, member A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FAM72
Motif
Other DBs
NCBI-GeneID: 681249
NCBI-ProteinID: NP_001074920
RGD: 1598023
Ensembl: ENSRNOG00000042747
UniProt: A1KXW8
Position
13q13
AA seq 149 aa AA seqDB search
MSTNNCTFKDRCVSILCCKFCKQVLSSRGMKAVLLADTDIDLYSTDIPPTNTVDFIGRCY
FTGIHKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYGINRLDSTGV
NFLLWGNLPETEECTDEEMLEISAEEYIR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaacaactgtactttcaaagaccgatgcgtctccatcctgtgttgcaaattc
tgtaaacaagttctcagctctaggggaatgaaggctgttctgttggctgacactgacata
gacctttactctacagacattcctcctaccaacacagtggatttcattggaagatgctat
ttcacaggaatccacaagtgtaaactgaaggacatcgcatgtttaaaatgtgggaacatt
gtaggctaccatgtgattgttccgtgtagctcctgccttctttcctgcaacaatggacac
ttctggatgtttcacagccaggcggtttatggtataaacagactagactcgactggtgta
aacttcctactttggggcaatttgccagagacagaagaatgcacagatgaagaaatgcta
gagatttcagcagaagagtatattcgatga

DBGET integrated database retrieval system