KEGG   Rattus norvegicus (rat): 681352
Entry
681352            CDS       T01003                                 

Gene name
Letmd1
Definition
(RefSeq) LETM1 domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: LETM1
Other DBs
NCBI-GeneID: 681352
NCBI-ProteinID: NP_001116253
RGD: 1596738
Ensembl: ENSRNOG00000029855
UniProt: G3V996 B0K026
Position
7
AA seq 360 aa
MALSRVCWSRAALWGSTVAPGPFVTRRLQLGRSGPAWRAPRSSKLHLSPKADVKNLISYV
VTKTRAINGTYHRFLGRHFPRFYALYTTFIKGIQMLWADAKKARRIKADMWKQNLKFHQL
SYREMEHLRQFRRDITKCLFIGLISIPPFANYLVFLLMYLFPRQLLVKHFWTPKQQIDFL
DIYHGFRRRSHLEIITHLRRASALVSNEKLRWHLEDLCTKVQNGTHPTAQDILALRDCFS
TYPLGFSQLQASQMRALSQAMLLTPYLPPPLLRWRLKSHTAVIHQLDRALAKLGTGHLTP
QEVRSACYLRGLNSTHTSDDRCRTWLGEWLHISCSLKEAELSLLLHNVVLLSTNYLETRR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcgctgtccagggtgtgctggtctcgggctgctctgtggggttcgaccgtcgcccct
ggaccctttgtcacccggaggctgcagttgggccgctctggccctgcgtggcgagcccct
cggtcttcaaagcttcacctttctccaaaggcggacgtgaagaacttgatttcttacgtg
gtgaccaagacgagggcgattaacggaacgtaccaccgtttcttggggcgtcacttcccc
cgcttctatgccttgtacacaaccttcataaaaggaatacagatgttatgggctgatgcc
aaaaaggctagaagaataaaggcagacatgtggaaacaaaatctaaagtttcatcaactc
tcttaccgggagatggagcatttgagacagttccgacgagatatcaccaagtgtctcttc
ataggcctcatctccattccaccctttgccaactacctggtcttcttgctaatgtacctg
tttcctaggcaactgcttgtcaagcatttctggacccccaaacaacaaattgacttcttg
gacatttatcatggtttccggaggcggtcccacttggaaatcatcacgcatctcagaagg
gctagcgctttggtttctaatgagaagctccggtggcatctggaggacctgtgtaccaag
gtgcagaatggcacccacccaacggcacaggacatcctggctctcagagactgcttctct
acctatcccttgggcttcagccagctccaggcttctcaaatgagagccttgagccaggcc
atgctgctcacaccttacctgcccccgcctttgctgaggtggcgtctgaagagccacacc
gctgtgattcaccagctggaccgggctctggcaaagctggggactggtcacctgactccg
caggaagtgagatcggcttgctatcttcgtggcttgaactctacccacacctctgatgac
aggtgtcgaacttggctgggagaatggctgcacatctcctgcagcctaaaagaagctgag
ctgtctctcttgctgcacaacgtggtcctgctctccaccaactaccttgagacaaggcgc
tga

DBGET integrated database retrieval system