KEGG   Rattus norvegicus (rat): 681407
Entry
681407            CDS       T01003                                 

Gene name
Rnf148
Definition
(RefSeq) ring finger protein 148
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-RING_2 PA zf-C3HC4_2 zf-rbx1 zf-C3HC4 zf-RING_11 zf-RING_5 zf-C3HC4_3 zf-RING_UBOX Prok-RING_4 zf-ANAPC11 Zn_ribbon_17 Zf_RING DUF3975 zinc_ribbon_16
Other DBs
NCBI-GeneID: 681407
NCBI-ProteinID: NP_001178011
RGD: 1595417
Ensembl: ENSRNOG00000042462
UniProt: F1M1T7
Position
4q22
AA seq 316 aa
MCVCVSDVTVNGGMNPPGLTPSAHRSVSSRLLRLSVFLLLSLPDTKGKAIWTAHLNITFQ
VGNRIISELGESGVFGNHSPLERVSGAVVLPEGWNQNACSPLTNFSRPDQADSWLALIER
GGCTFTHKINVAAEKGANGVIIYNYPGTGNKVFPMSHQGTENIVAVMIGNLKGMELLHLI
QQGVYVTIIIEVGRMHMPWLSHYVMSLFTFLAATVAYLFLYCAWRPRAPNSSTRRQRQIK
SDVKKAIGQLQLRVLKEGDKELDPNEDSCVVCFDIYKAQDVIRILTCKHFFHKTCIDPWL
LAHRTCPMCKCDILRS
NT seq 951 nt   +upstreamnt  +downstreamnt
atgtgtgtgtgtgtgtcagatgtcacagttaatggaggaatgaacccacctggacttacc
ccttcagctcataggtctgtttcctctcggctcttgagacttagtgtcttcttactgctt
agcctccctgacaccaaaggaaaagcaatatggactgctcatctgaatattaccttccag
gtgggaaaccggatcatatcggagctaggagagagtggagtgtttgggaatcattcgcct
ctggaaagggtgtctggtgctgtggtacttccggaagggtggaatcagaatgcttgcagt
cccctgaccaacttcagcaggcctgatcaggcagactcttggctggccctcatcgaacgg
ggaggctgcacttttactcataaaatcaatgtggcagcagagaagggagcaaacggggtg
atcatctataactatccgggtacaggcaacaaggtatttcccatgtctcaccagggaacg
gagaatatagttgcagtgatgatcggcaatctcaagggcatggagctcttgcacttgatc
cagcaaggtgtctatgtgacgatcatcattgaagtggggagaatgcatatgccgtggctc
agccactatgttatgtctctgtttaccttcctggcagccacagtcgcctacctattcctg
tactgtgcctggagaccccgagcacccaattcttctaccaggaggcaaagacagataaag
tctgatgtgaagaaagctattggtcagctgcaacttcgagtgctcaaggaaggggataag
gagctagacccaaatgaagacagctgtgttgtttgtttcgatatatacaaagcccaagat
gtaatacgtattttaacttgcaagcattttttccacaagacgtgcattgatccgtggctt
ttagcccacaggacgtgccccatgtgcaagtgtgacattctgagatcttaa

DBGET integrated database retrieval system