KEGG   Rattus norvegicus (rat): 681458Help
Entry
681458            CDS       T01003                                 

Definition
(RefSeq) similar to stearoyl-coenzyme A desaturase 3
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01040  Biosynthesis of unsaturated fatty acids
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
rno04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    681458
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    681458
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    681458
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     681458
Lipid biosynthesis proteins [BR:rno01004]
 Desaturase
  First
   681458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 681458
NCBI-ProteinID: XP_008758709
RGD: 1595370
Ensembl: ENSRNOG00000013279
UniProt: Z4YNJ9
Position
1q54
AA seq 359 aa AA seqDB search
MPGHLLQEEMTPSYTTTSTITEPPSGVMQKGKEKLKTLPLYLEEDIRPEMREDIHDPSYQ
DEEGPPPKLEYVWRNIILMALLHVGALYGITLIPSSKVYTLLWAFIYYAISIEGIGAGVH
RLWSHRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFTETHADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGILLLCFILPTLVPWYFWGE
TFLHSFYVATLLRYAVVLNVTWLVNSAAHLYGYRPYDKNIDPRENALVSLGTLGEGFHNY
HHAFPYDYSASEYPWHINFTTFFIDCMAFLGLAYDRKRVSKATVLARIKRTGDGSHKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccaggccacttgttgcaagaagagatgactccttcatacacaaccacctccaccatc
acagagcctccctctggagtcatgcagaaaggaaaagaaaaattaaagactctgcccctc
tacctggaagaagacatccgtcctgaaatgagagaagatatccacgaccccagctaccag
gatgaggaggggcccccgcccaagctggagtacgtctggaggaacatcatcctcatggcc
ctgctgcacgtgggagccctgtacgggatcacactgatcccctcctccaaggtctacacc
ttgctctgggcattcatctactatgcgatcagtattgagggcattggagctggagttcat
cgcttgtggagccacaggacttacaaggctcgcctgcccctgagaatcttcctcatcatt
gccaacaccatggctttccagaacgatgtgtatgaatgggcccgggatcaccgcgcccac
cacaagttcacagaaacacacgccgaccctcacaactcccgccgtggctttttcttctct
cacgtgggttggctgcttgtgcgcaaacacccggctgtcaaagagaagggcggaaagctg
gacatgtctgacctaaaagctgagaagctggtgatgttccagaggaggtactacaagccc
ggcatcctgctcttgtgcttcatcctgcccacgctggtgccctggtatttctggggtgaa
acttttctacacagtttttatgttgccaccttactgagatatgccgtagtgctcaacgtc
acctggctggtgaacagtgccgcccacctctatggatatcgcccctacgacaagaacatt
gatccccgggagaatgccctggtttccttggggactctgggcgagggcttccacaactac
catcacgccttcccctacgactactctgccagtgagtacccctggcacatcaacttcacc
acgttcttcatcgactgcatggctttcctaggcctggcttacgaccggaagagggtgtcc
aaggccactgtcttagccaggattaagagaactggagatgggagccacaagagtggctga

DBGET integrated database retrieval system