KEGG   Rattus norvegicus (rat): 681544
Entry
681544            CDS       T01003                                 

Gene name
Hrg, RNHRG2
Definition
(RefSeq) similar to histidine-rich glycoprotein
  KO
K23410  histidine-rich glycoprotein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    681544 (Hrg)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I25: cystatin family
   681544 (Hrg)
SSDB
Other DBs
NCBI-GeneID: 681544
NCBI-ProteinID: NP_001316829
RGD: 1594092
UniProt: Q99PS8
Position
11
AA seq 515 aa
MKVLTTALLLVTLQCSHALSPTNCDASKPLAEKVLDLINKGRRSGYTFQLLRVSDAHLDR
VETATIYYLVLDVIESDCWVLSTKAQDECLPARWTSEIVIGQCKVIATRYSNESQDLSVN
GYNCTMRSVSSALSNTKDSPVLFDFFEDSEPYRKLARKALDKYKEENGDFASFRVERAER
VIRGRGGERTSYFIEFSVRNCSTQHFPRHPPVFGFCRAVLSYSIEASDLETPEYTDVTCE
VVNTEDLKNRSDMKPHRGHEHPHCDKHLCKLSGPRDHHHTHKTHEIGCPPPPEGKDNSDR
PPLQEGALPQMLPGHSGPSGTNRSHRPPHNHSCNEHPCHGQHPHGHHPHGQHPHGHHPHG
QHPHGHHPHGHHLHRHHPHGHHPHGDHPHGHHPHGHDFLDYGPCDPPSNSQELKGQYHRG
HGPPHGHSRKRGPGKGLFPFHQRQIGYVYRLPPLNVGEVLTPPEANFPSFSLPNCNRPPQ
PEIQPFPQTASKSCPGKFESKFPQVSNFFEHTPPK
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgaaggtgctcaccacagcattgcttctagtcaccctgcagtgttcccatgccctgagt
cccaccaactgtgatgcctccaagcctttggctgagaaagttctagacttgatcaataaa
gggcggaggagtggctatacttttcagctgctgcgggtctctgatgcccacttggacaga
gtggaaactgccaccatctactacttagttttagatgtgatagaatctgactgttgggtc
ctctccacaaaagcccaggatgagtgtcttccagccaggtggacatctgagatagtgatt
ggacagtgtaaggtaatagccacaagatactcaaatgagtctcaagatcttagcgtgaat
ggctataactgcaccatgagatccgtctcttcagcacttagcaacaccaaagacagtcct
gtactcttcgacttctttgaggattccgagccctacagaaagctagcccggaaagccctc
gacaagtacaaagaggagaatggtgactttgcctcattcagagtggaacgagctgaaagg
gttataagagggagaggaggggaaagaaccagctacttcatagaattctcggtgaggaac
tgttccacacaacacttccccagacaccctccggtctttggattctgcagagcagttttg
tcctacagtatagaagcctctgacttggaaaccccagaatacactgacgtgacctgtgaa
gttgtcaacactgaggatcttaaaaacaggagtgacatgaaaccccatcggggccatgag
catcctcattgtgacaaacatctgtgtaagctcagtggacccagggaccatcatcatacc
cataagacacatgaaattggatgcccaccaccaccagaaggaaaagataactcagacaga
ccaccacttcaagaaggagcccttccacaaatgctccctggccattctgggccttctggt
accaacaggagccatagaccccctcataatcacagttgtaatgagcatccttgccatgga
cagcatccccatggacaccaccctcatggtcagcatccccatggacaccaccctcatggt
cagcatccccatggacaccaccctcatggtcaccatcttcacaggcaccacccccatggt
caccatcctcatggtgaccatccccatggacaccacccccatggacatgatttccttgac
tatggaccttgtgacccaccctccaatagccaagaactcaagggtcagtatcatcgggga
catggtccaccacacggacactcaaggaaaagagggccaggtaaaggactctttcctttc
caccaacgacaaatcggatatgtctaccgactccctccactgaatgtaggtgaagttctc
actcctcctgaagccaatttccccagcttctccttgccaaattgcaacagacccccacaa
ccagagattcagcccttccctcagacagcctcaaagtcctgtccagggaaatttgagagt
aagtttccacaagtttccaacttttttgaacatacgcctccaaaataa

DBGET integrated database retrieval system