KEGG   Rattus norvegicus (rat): 681694
Entry
681694            CDS       T01003                                 

Gene name
Liph
Definition
(RefSeq) lipase H
  KO
K19404  phosphatidic acid-selective phospholipase A1 [EC:3.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    681694 (Liph)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     681694 (Liph)
SSDB
Motif
Pfam: Lipase Abhydrolase_6 Abhydrolase_2 Abhydrolase_3 UPF0227 A_amylase_inhib
Other DBs
NCBI-GeneID: 681694
NCBI-ProteinID: NP_001037744
RGD: 1592849
UniProt: Q32PY2
Position
11q23
AA seq 451 aa
MLRLCFLLSFMCLVKSDTDETCPSFTRLSFHSAVVGTGLSVRLMLYTQRDQTCAQVINST
ALGSLNVTKKTTFIIHGFRPTGSPPVWMEELVQSLISVQEMNVVVVDWNRGATTVIYPHA
SSKTRKVALILKEFIDQMLAKGASLDNIYMIGVSLGAHIAGFVGEMYSGKLGRITGLDPA
GPLFNGRPPEDRLDPSDAQFVDVIHSDTDALGYREALGHIDFYPNGGLDQPGCPKTIFGG
IKYFKCDHQMSVFLYLASLQNNCSITAYPCDSYRDYRNGKCVSCGAGHIVSCPSLGYYAD
NWREYLWDRDPPMTKAFFDTAETKPYCIYHYFVDIISWNKSVRRGFITIKLRGEDGNITE
SKIDHEPSAFQKYHQVSLLARFNRDLDKVAEISLLFSTKSVVGPKYKLRVLRMKLRSLAH
PDRPHLCRYDLVLMENVETFFQPILCSKQQM
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgctgagactgtgctttctcctcagtttcatgtgcttggtgaaatcagatacggatgaa
acatgcccgtccttcaccaggctgagcttccacagtgcagtggttggtacagggctctcc
gtgagactgatgctctacacacagagagaccagacctgcgcacaagtcatcaactccaca
gccctggggagcttaaatgtgaccaagaaaaccacgtttattatccatggtttccggcca
accggctctcctccggtttggatggaggagttggtacagagtttgatcagtgtacaagag
atgaatgtggtggttgttgattggaatcgaggagctacgactgtgatatacccccatgct
tctagcaagaccagaaaagtagctctgattttgaaggaatttatcgaccagatgctggcc
aaaggagcttctctggacaacatttacatgattggagtaagtctaggagcccacatagct
ggatttgttggagaaatgtattccgggaagctggggagaatcacaggtcttgaccctgca
ggccctttattcaacgggagacctcctgaggacagattagatcccagcgacgcacagttc
gtggacgtcatccactcggacactgacgcactgggctacagggaagcactagggcacata
gacttctatccgaacggaggactagatcaaccggggtgccccaagacaatatttggaggt
ataaagtacttcaagtgtgaccaccagatgtccgtcttcctgtaccttgcatccctgcaa
aataactgctccatcacagcctatccctgcgactcctatcgggattataggaacggcaag
tgtgtcagctgtggtgctggacacatcgtgtcctgtcccagtctcggctactatgctgac
aactggagagagtacttatgggacagagatcctccgatgacgaaggcgttcttcgacacg
gctgagacaaagccatactgcatctatcattattttgtggacatcatatcttggaacaag
agcgtgagaagagggttcattacaatcaagctgagaggcgaagatggaaatatcacagaa
tccaaaattgatcatgagccatctgcattccagaagtaccatcaagtgagtcttctcgca
agatttaatcgagatctggataaagtggcagaaatttccttgttgttctccacaaagtct
gtagtgggcccaaagtacaagctcagggtcctgcgaatgaagctgaggtccctggcccat
ccagacaggcctcacttgtgccggtatgatctcgtccttatggagaatgttgagacattc
ttccaacctatcctgtgctccaagcagcagatgtag

DBGET integrated database retrieval system