KEGG   Rattus norvegicus (rat): 681896
Entry
681896            CDS       T01003                                 

Gene name
Slc25a18
Definition
(RefSeq) solute carrier family 25 member 18
  KO
K15107  solute carrier family 25 (mitochondrial glutamate transporter), member 18/22
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    681896 (Slc25a18)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   681896 (Slc25a18)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 681896
NCBI-ProteinID: NP_001037745
RGD: 1590470
Ensembl: ENSRNOG00000042731
UniProt: Q505J6
Position
4q42
AA seq 320 aa
MIACRMSSQDLSITAKLINGGIAGLVGVTCVFPIDLAKTRLQNQQGKDVYKGMTDCLVKT
ARAEGFLGMYRGAAVNLTLVTPEKAIKLAANDFLRQLLMQDGTQRNLKMEMLAGCGAGIC
QVVITCPMEMLKIQLQDAGRLAVCQQASASATPTSRPYSTGSTSTHRRPSATLIAWELLR
TQGLSGLYRGLGATLLRDIPFSIIYFPLFANLNQLGVSELTGKASFTHSFVAGCAAGSVS
AVAVTPLDVLKTRIQTLKKGLGEDTYRGVTDCARKLWTQEGAAAFMKGAGCRALVIAPLF
GIAQGVYFIGIGERILKCFE
NT seq 963 nt   +upstreamnt  +downstreamnt
atgatcgcctgcaggatgtccagccaggacctgagcatcactgcaaaactcatcaatgga
ggtatagcaggtctcgtgggggtgacctgcgtgttccccattgaccttgccaaaacccga
ctgcagaaccagcaagggaaagatgtgtacaaaggaatgacagattgcctggtgaagact
gcacgtgccgagggcttcttgggcatgtaccgaggggctgcagtgaacctcaccctggtc
actccagaaaaagcaatcaagttggcagccaatgacttcttgaggcagctgctcatgcaa
gatgggacccagcggaacctgaagatggagatgctggccggatgtggggctggaatatgc
caggtggtgatcacctgtcccatggaaatgctcaagatccagctgcaggatgccggccgc
ttagctgtctgtcagcaggcttctgcctcagccacgcccacctcccggccctacagcact
ggctcgacttccacccacaggcgcccatcggccaccctcattgcctgggagctgctccgc
actcagggcctctctggtctctacaggggactgggtgctactctcctcagagacattcct
ttctccatcatctacttccctttgtttgcaaacctgaaccaacttggggtcagcgagctc
actggcaaggcctccttcacacactcctttgtggcaggctgtgcagcaggctctgtctcg
gccgtagctgtcacccctctggatgttctgaagactcgaatccagaccctcaagaaaggc
ctgggtgaggacacctacaggggagtcactgactgtgccaggaaactctggacccaggag
ggagcagcagccttcatgaagggagcaggctgccgtgccctggtcatagcccccctcttc
gggattgcccagggtgtctacttcatcggcattggagagcgcatcttaaagtgctttgaa
taa

DBGET integrated database retrieval system