KEGG   Rattus norvegicus (rat): 681989
Entry
681989            CDS       T01003                                 

Gene name
Vipas39, Spe39, Vipar, hSPE-39
Definition
(RefSeq) VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog
  KO
K23287  VPS33B-interacting protein in polarity and apical restriction
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    681989 (Vipas39)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   Others
    681989 (Vipas39)
SSDB
Motif
Pfam: Vps16_C CEP209_CC5
Other DBs
NCBI-GeneID: 681989
NCBI-ProteinID: NP_001094474
RGD: 1589291
Ensembl: ENSRNOG00000049223
UniProt: Q5PQN6
Position
6q31
AA seq 460 aa
MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWT
GEPVGSISWSIKETAGSSGSTSEGREQMKGRNSFYTQLPKPPSTYSLSSFFRGRTRPGSF
QSLSDALSDTPAKTYSPELGRPKGEYRDYSNDWSLSDTVRRLRQGKVLIFLKRTLSKEIL
FRELEVRQVALRHLIHFLKEIGDQKLLLDLFRFLDRTEELALSHYREHLNIQDPEKRKEF
LKTCIGLPFSAEDSAHVQDQYTLLERQIIIEANDRHLESSGQTEIFRKHPRKASILNMPL
VTTLFYACFYHYTESEGTFSSPVNLKKTFKIPDRQYVLTALAARAKLRAWNDVDALFTTK
NWLGYTKKRAPIGFHRVVEILHKNSAPVQILQEYVNLVEDVDTKLNLATKFKCHDVVIDT
CRDLKDRQQLLAYRSKVDKGSAEEEKIDVILSSSQIRWKN
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaaccggacaaaaggtgatgaggaggaatattggaacagctccaagttcaaggcgttc
acttttgacgatgaagatgatgagctctcacagttaaaggaatccaaacgggcagtgaat
agccttcgagacttcgtggatgacgacgatgacgatgacctggagcgagtcagctggact
ggagaacctgtgggaagtatctcatggtccatcaaagagactgctgggagtagcgggtca
acctctgagggacgtgaacagatgaagggccggaacagcttctacacacaactacccaaa
cctccttccacctactccctgagcagcttctttagaggcagaactagacctgggagtttc
cagtccctttctgatgctctgtcagacacacctgccaaaacttattctccagagctgggg
aggcctaagggagagtacagggattacagcaatgactggagcctcagtgatacagtgcga
cgtctccgccagggcaaggttctgatcttcctgaagaggaccctgagcaaagagatcctt
ttccgagagctggaggtacgccaggtcgcactgagacatctcatccacttccttaaagaa
ataggggaccaaaagctgcttttagatctcttcaggttcctagatagaacagaagagctg
gcgctatcccattatcgagagcatttgaacattcaggaccctgaaaaacgaaaagaattt
cttaagacgtgcattggtttgcccttttcagcggaagactctgcacacgtgcaagaccag
tacacactgctggagcgccagatcatcatcgaggccaatgaccgacacctggagtcttca
gggcagactgagatcttccggaagcacccccgaaaagcttccatcctcaacatgccacta
gtgacgacactcttctacgcctgcttctatcactacacggagtccgaggggaccttcagc
agtccagtcaacctgaagaaaacattcaagatcccagacagacagtatgtgctgacagcc
ttggctgcgcgggccaagcttagagcctggaatgatgtcgatgccttgttcaccacaaag
aactggttgggttacaccaagaagagagcacccattggcttccatcgagttgtggaaatt
ttgcacaagaacagtgcccctgtccagatattgcaggaatatgtcaatctggtggaagat
gtggacacaaagttgaacttagccactaagttcaagtgccatgatgttgtcattgatact
tgccgagacctgaaggatcgtcaacagttgcttgcatacaggagcaaagtagataaagga
tctgctgaggaagagaaaatcgatgtcatcctcagcagctcgcaaattcgatggaagaac
taa

DBGET integrated database retrieval system