KEGG   Rattus norvegicus (rat): 682390Help
Entry
682390            CDS       T01003                                 

Gene name
Eif3i, Eif3s2, TRIP-1
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit I
  KO
K03246  translation initiation factor 3 subunit I
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    682390 (Eif3i)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    682390 (Eif3i)
Translation factors [BR:rno03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    682390 (Eif3i)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 682390
NCBI-ProteinID: NP_001108507
RGD: 1584560
UniProt: B0BNA7
Position
5q36
AA seq 325 aa AA seqDB search
MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA
DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC
FVSFFDLRDPSQIDSNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEV
LVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTSLEHQKTFRTERPVNSAALSPN
YDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSY
SSGGEDGYVRIHYFDPQYFEFEFEA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccatcctgcttcagggccatgagcggtccatcacgcaaatcaagtacaaccgc
gaaggagacctccttttcactgtggccaaagaccccatcgtcaatgtgtggtattctgtc
aatggcgagaggctaggcacctacatgggccacactggagctgtgtggtgtgtggatgct
gactgggacaccaagcatgtccttactggctcagctgacaacagctgtcgtctctgggac
tgtgaaacagggaagcagctggccctactcaagaccaactcagccgtgcggacctgtggc
tttgactttgggggcaacatcatcatgttctccacagacaagcagatggggtatcagtgt
tttgtgagcttctttgatctgcgggatccaagccagattgacagcaacgagccctacatg
aagatcccctgtaatgattccaagatcaccagtgctgtttggggtcccctgggggagtgc
atcatcgcaggccacgagagcggagagctcaaccagtacagcgccaagtctggagaggta
ttggtgaacgttaaggaacactcccggcagatcaatgacatccagttgtctagagacatg
accatgtttgtcaccgcatccaaggacaacacagctaagctcttcgactccacaagtctt
gaacatcagaagactttccgaacagaacgtcccgtcaactcggctgctctctctcccaac
tatgaccatgtggtgctgggaggtggtcaggaagccatggatgtgaccacaacctccacc
aggattggcaagtttgaggccaggttcttccatttggcttttgaggaagagtttggaaga
gtcaagggccactttggacctatcaacagtgttgccttccatcccgatggcaagagctac
agcagcggtggcgaagacggctatgtccgcatccactacttcgaccctcagtacttcgag
ttcgagtttgaggcctga

DBGET integrated database retrieval system