KEGG   Rattus norvegicus (rat): 682507
Entry
682507            CDS       T01003                                 

Gene name
Wasl
Definition
(RefSeq) neural Wiskott-Aldrich syndrome protein
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04520  Adherens junction
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    682507 (Wasl)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    682507 (Wasl)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    682507 (Wasl)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    682507 (Wasl)
   05135 Yersinia infection
    682507 (Wasl)
   05100 Bacterial invasion of epithelial cells
    682507 (Wasl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    682507 (Wasl)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    682507 (Wasl)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    682507 (Wasl)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     682507 (Wasl)
SSDB
Motif
Pfam: WH1 PBD WH2 DUF4918 PQQ
Other DBs
NCBI-GeneID: 682507
NCBI-ProteinID: NP_001103835
RGD: 735144
Ensembl: ENSRNOG00000006975
UniProt: F1LSG0
Position
4
AA seq 501 aa
MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSG
VACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFAN
EEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYGSQVNNIS
HTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISE
AQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPP
ARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPP
LSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSGNKAALLDQIREGAQLKKVEQ
NSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHS
SDEDEDDDDEEDFEDDDEWED
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgagctcgggccagcagcccccgcggagggtcaccaacgtgggctccctgctgctcacc
ccgcaagaaaacgagtctcttttctccttcctcggcaagaaatgtgtgactatgtcttca
gcagtggtgcagttatatgcagctgatcggaactgtatgtggtcaaagaagtgcagtggt
gttgcttgtcttgttaaggacaatcctcagagatcttattttttaagaatatttgacatt
aaggatgggaaattactgtgggaacaagagctatacaataactttgtatataatagtcct
agaggatattttcatacctttgctggagatacttgtcaagtagctcttaattttgccaat
gaagaagaagcaaaaaagttccgaaaagcagttacagacctgttgggtcgacgacaaagg
aaatctgaaaaaagacgagatgctccaaatggtcccaatctacccatggctacagttgac
ataaaaaatccagaaatcacaacaaacaggttttatggttcacaagtcaacaacatctcc
cacaccaaagaaaagaagaaaggaaaagctaaaaagaagagattaaccaaggcagatatt
ggaacaccaagtaatttccagcacattggacatgttggttgggatccaaatacaggtttt
gatctaaataatttggatccagaattgaagaatctttttgatatgtgtgggatctctgag
gcccagcttaaagacagagaaacatcaaaagttatttatgactttattgaaaaaacagga
ggtgtagaagctgttaaaaatgaactccgaaggcaagcaccaccacctcctccaccctca
agaggaggacctccccctcctcctccccctcctcacagctcaggccctcctccccctcct
gcccgtggaaggggggctcctcccccgccaccatcaagagctcctactgctgcacctcca
cctccacctccttctaggcctggtgttgtcgttcctccacctcctccaaacaggatgtac
cctcctccaccaccagccctgccttcctcagcaccttcaggcccaccaccacctccgcct
ctgtctatggcagggtccacagcaccaccacctcctccaccacctccccctccaccaggg
ccaccacctccccctggcctgccttctgatggtgaccatcaagttccagcttcttcagga
aacaaagcagctcttttggatcaaattagagagggtgctcagctaaaaaaagtggagcag
aatagtcggcccgtgtcctgctcaggaagggatgcacttctagaccagatacgacagggc
attcagttgaaatccgtgtctgatggccaagagtccacaccaccaacccccgcgcccact
tcaggaattgtgggtgcgctgatggaagtgatgcagaaaaggagcaaagccattcattcc
tcagatgaagatgaagatgatgatgatgaagaagattttgaggatgatgatgagtgggaa
gactga

DBGET integrated database retrieval system