KEGG   Rattus norvegicus (rat): 682787
Entry
682787            CDS       T01003                                 

Gene name
Sumo4, Sumo2l
Definition
(RefSeq) small ubiquitin-like modifier 4
  KO
K12160  small ubiquitin-related modifier
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    682787 (Sumo4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    682787 (Sumo4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    682787 (Sumo4)
   03029 Mitochondrial biogenesis [BR:rno03029]
    682787 (Sumo4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    682787 (Sumo4)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   682787 (Sumo4)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    682787 (Sumo4)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    682787 (Sumo4)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin
Other DBs
NCBI-GeneID: 682787
NCBI-ProteinID: XP_002729504
RGD: 1595256
Ensembl: ENSRNOG00000032840
UniProt: F1LN30
Position
5q12
AA seq 95 aa
MADEKPKEGVKTENNDHINLKAVGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
EFDGQPINETDTPAQLEMEDEDTIDVFRQQTGGVY
NT seq 288 nt   +upstreamnt  +downstreamnt
atggccgacgagaaacccaaggaaggagtcaagactgagaacaacgaccatattaatttg
aaggcggtgggacaggatggttctgtggtgcagtttaagattaagaggcatacaccactt
agtaaactaatgaaagcctattgtgaacggcagggtttgtcaatgaggcagatcagattc
gagtttgatgggcaaccaatcaacgaaacagacacacctgcacagttggaaatggaggat
gaagatacgattgatgtgttccggcagcagacaggtggtgtctactaa

DBGET integrated database retrieval system