KEGG   Rattus norvegicus (rat): 682837
Entry
682837            CDS       T01003                                 

Gene name
Muc5ac
Definition
(RefSeq) mucin-5AC
  KO
K21125  mucin-5AC
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    682837 (Muc5ac)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    682837 (Muc5ac)
Membrane trafficking [BR:rno04131]
 Others
  Mucins
   Secretory mucins
    682837 (Muc5ac)
SSDB
Motif
Pfam: VWD Mucin2_WxxW C8 TIL VWC
Other DBs
NCBI-GeneID: 682837
NCBI-ProteinID: XP_038957197
RGD: 62001
Position
1
AA seq 3353 aa
MGVGRRKLAPFWVLALALTFNQHTGQALEDTRKSHLEHYSDLSQPQGHVGTPLNRVTIIP
PLKTIPVVRAFNPAHTRRVCSTWGNFHYKTFDGQVFYFPGLCNYVFSEHCGAAYEDFNIQ
LRRGLESNSTTLSRVIMKLDGLVVELTKSSVLVNNHPVQLPFSQSGVLIELSNGYLKVVA
RLGLVFMWNDDDSLLLELDTKYANKTCGLCGDFNGSPESSEFLSHNVRLTPLEFGNFQKM
DGPTEQCQDPLPVPQKNCSIRSSICEEILKGQLFSNCAALVDISSYLEACQQDLCLCESS
DPSNCICHTLAEYSRQCAHAGGQPQNWRGPNLCPQTCLLNMEYQECGSPCVDTCSNPQHS
QVCEDHCVAGCFCPEGMVLDDSNQTGCVPVSQCACLYNGTLYAPGTSYSTDCTNTCSGGQ
WSCQEVPCSGTCSVMGGSHISTFDERQYTVHGDCSYVLCKPYDSNAFTVLAELRKCGLTE
SETCLKTVTLNLGGGKTVITVKATGEVFVNQIYTQLPVSTANATFFRPSTFFIIGQTNLG
LQLEIQLHPIMQVSVRIAPEFRGLTSGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKT
QAACPNVKNIFEDPCSLSVENEKYAQHWCSQLTDANGPFSQCHATVNPSTFFSNCMFDTC
NCEKSEDCLCAALSSYVRACAAKGVLLSDWREGICEKPTITCPKSMTYQYHISTCQPTCR
SLSEEDVTCHVNFIPVDGCTCPKGTFLDDSGKCVQATSCPCYYKGSPVPNGESVHDNGAI
CTCTQGALTCIGGPVLTPVCDAPMIYFDCRNATPGDTGAGCQKSCHTLDMTCYSSECVPG
CVCPNGLVADGNGSCVVAEDCPCVHNEATYRPGETIQVGCNNCTCENRMWQCTDKPCLAT
CAVYGDGHYITFDGQRYSFSGDCEYTLLQDNCGGNGSSQDAFRVVTENIPCGTTGTTCSK
GIKIFLGSYELKLSDSKMEVVQKGVGQEPPYFVHQMGNYLVVETDIGLVLLWDKKTSIFL
RLSPEFKGKVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDASVSKDPCT
ANPYRKSWAQKQCSIINSATFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTAVAAY
AQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRG
LEGCYPKCPPTAPIFDEGTMQCVSNCTVSPSPCRVNGKLYRPGTPIPSDENCYSCVCTES
GVNCTHDAGACVCTYNGQRYHPGDTIYHTTDGMGGCISAHCRDNGTIERIVDTCSSTSPP
PPTTFSFSTTLVMTSMQPSSTHSSPTPSVVYPGSPSKAVLTASSVSSVKTPETTSVLTTS
TSASTLTMPACQEECLWSPWMDISRPGRGIDSGDFDTLENLHAHGYQICPVPKAVECRAE
DNPGVPFHALQQHVECSTTVGLICYNSDQVSGLCDNYQIKIQCCTPINCPTSTGPTQTTH
LIVSRTSTMEDTTSSVPVTSTEHTYSTVASSPSTHTPGPSPSSSVPSSSAPARSTPTPVS
STTVKTTLPTTSPMPEPTSATSSVSISTLGSTLASPEITHGCRKELCNWTDWIDGSYPEP
GRSSGDFDTFVNLRAKGYKFCEKPWNVECRAQFFPNTPLQELGQDVTCSREVGLICLNKN
QLPPICYNYEIRIECCTIVNICSTTSATTQPTSHGVSIKTKTNWITNTYSFSTENTSGHS
TVINTKTWVTGSTHTTPQPGTTHCQPQCNWTKWLDTDFPVPGPHGGDLETYGNIKKSGER
LCPWPEEITRLECRAKDYPERAMEDLGQVVQCDPSVGLVCKNSDQGPTFGMCLNYEVRLL
CCHVPEDCLTTKRTTLSSTQSTTVTSSTPGTTSMPQTMTTIVQTDSTTSTSQTSSPITGR
ASTIHTTQTTSTSTGEAWTSSVQIASTTSTTHTSSPNTGRVSTTHRTHSSSPPTGGTSPT
HRTHTSSPPTGGTSPTSTTHISSPPTGGTSPTSTTHTSSPNTGRVNTTHTTHTSSPPIGE
NSTTSTSQTSSPITGRASTIHTTQTTSTSTGEAWTSSVQIASTTSTTHTSSPNTGRVSTT
HRTHTSSPPIGGTSPTPTTHTSSPPTGGTSPTSTTHTSSPPIGGTSPTSTTHTSSPPTGG
TSPTSTTHTSSPPTGGTSPTHRTHTSSPPTGGTSPTSTTHTSSPPTGGTSPTSRTHTSSP
PTGGTSPTSTTHTSSPPTGGTSPTSTTHTSSPPTGGTSPTHRTHTSSPPTGGTSPTSTTH
TSSPNTGRVNTTHTTHTSSPPIGESSTISTTDIRTSSTQMAHTTFVGKTSTISGPGTSTT
SIPTSTTGSSSHFEVTRSPVTAHCQPQCNWTKWLDTDFPVPGPHGGDLETYGNIKKSGER
LCPWPEEITRLECRAKDYPERAMEDLGQVVQCDPRVGLVCKNSDQGPTFGMCLNYEVRLL
CCHIPEDCLRTDRTPVTSHKTSFPVVSSSSVSTSSSTSPRVHSTTRCFCTMSGQLYPLGT
IIYNQTDLDGHCYYAMCSHDCQVVKGVSQDCPSTMPPRTPTLSTSTAPPVTERDWCNVFP
PRLKGETWPMPNCSQATCEGNNVVSLSPRQCPEVKEPSCANGYPPLKVDDQDGCCQHYQC
QCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVFGDFRVLIDNYYCDLGDSVSCPQ
SIIVEYHQDRVVLTRRPVHGVMTNQIIFNNKVVSPGFQQNGIIISRVGIKMYVTIQEIGV
QVMFSGLIFSVEVPFNLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVPNQ
PSCQGPPPTPTSMVPRSTPTPCSPSPLCQLILSDVFKLCHDIIPPLQFYEGCLFDYCHML
DLEVVCSGLELYASLCAAQGVCIPWRSHTNNTCPFTCPENQVYQPCGPSNPHYCYRNDDI
SLSLAIQKAGPKSEGCFCPDDMTLFSSNDSICVPSCQWCLGPHGEPVEPGHTISINCQDC
ICKEGTLTCQEKLCPQPTCPEPGFVPVSVALEAGQCCSQFSCVCNSSHCPPPLHCPESSS
LIVTYEEGTCCPSQNCSSQKGCDVNGTLYQPGDVVSSSLCERCLCEVSSNAFSDGFVVNC
EIELCNTQCPKGFEYQTTPGHCCGHCIPKTCPFKNSNNSTSLYKPGEFWPEPGNPCVTHK
CEKFQDVLTVVTMKIECPKINCPQDQAQLREDGCCYDCLVPQQKCTVHQRQQIIRQQNCS
SEGPVSLSYCQGNCGDSTSMYSLEANTVEHTCECCQELQTSQRSVTLHCDDGSSRTFSYT
QVEKCGCLGQRCHAPGDTSHSESSEQEFKSKESEEPGQQSASRVSEDTLGPFQ
NT seq 10062 nt   +upstreamnt  +downstreamnt
atgggtgttggccggagaaagttggccccattctgggtcctagccttggctctgaccttc
aaccaacacacaggtcaggcccttgaggacactcggaaatctcaccttgaacactactct
gacttatctcaacctcaagggcatgttggtaccccactcaatagagtgaccatcatccca
cctctgaagaccattcctgtggtacgagccttcaacccagcacataccaggcgggtgtgc
agcacatggggcaacttccactacaagacctttgatggacaggtcttctacttccctggt
ctgtgcaactatgtgttctcggaacactgtggggctgcctacgaggacttcaatatccag
ctacgccgtggcctggagtctaattccaccactctgagcagggtcatcatgaagcttgat
ggcctagttgttgagctgaccaagagctccgtcttagtcaataaccacccggtccagctg
cccttcagccagtctggggtcctcattgagctcagcaatggctacctgaaggtggtggcc
aggctggggctggtcttcatgtggaatgatgatgacagtcttctgctggagttggacacc
aaatatgccaacaagacttgtggtctctgtggagacttcaatggcagtccagaatccagc
gagtttctctcccacaatgttaggctgacaccccttgagtttgggaactttcagaagatg
gacggccccacagagcagtgccaggaccccctccccgtgccccagaagaactgctccatc
agatctagcatctgtgaagagatcctgaaaggtcagctgttctcaaactgtgcggccctg
gtggacatcagcagctacctggaggcttgccagcaggacctctgtctctgtgagagctct
gacccgtctaactgcatctgccataccctggctgagtactctcggcagtgtgcacatgcc
ggaggacagcctcagaactggcggggtcccaacctctgccctcagacctgtctcctcaac
atggagtaccaggaatgtggctcaccctgtgtagacacctgctccaacccccagcattcc
caggtctgtgaggaccactgtgttgctggctgcttctgtcctgagggtatggtgcttgat
gacagtaaccagacgggctgtgtccctgtgtcccagtgtgcttgcctgtacaatgggaca
ttgtatgcaccgggtaccagctattctactgactgcaccaacacgtgctctggaggtcag
tggagctgccaggaagtcccatgctctggtacctgctcagtaatgggaggctcccacatc
tccacgtttgatgaaaggcagtacacagtacatggggactgcagctacgtgctgtgcaag
ccctatgacagcaatgccttcactgtgctggctgagctgcggaagtgtggattgactgag
agcgagacttgtctgaagactgtgacgttgaacctgggtggggggaagacggtgatcaca
gtgaaagccactggagaggtctttgtgaaccagatctatacccagctgccggtatccaca
gccaacgctaccttcttccggccttcaaccttcttcatcattggccagaccaacctgggt
ttgcagcttgagatccagctgcatcccattatgcaggtgtccgtgcgcatagcacccgag
ttcagggggctaacctccgggctctgtggtaatttcaacagtatgcaggccgatgacttc
cagaccatcagtggggttgtggagggcacagcagctgctttcttcaacaccttcaagact
caggcggcttgtcccaatgttaagaatatctttgaggacccctgctcgctcagcgtggag
aatgaaaagtatgcgcagcactggtgttctcagctgactgatgccaatggcccattttcc
cagtgccatgccacagtgaaccccagcaccttcttctcgaactgcatgtttgacacgtgc
aactgtgagaagagtgaggactgcctgtgtgccgccctgtcctcctatgtgcgtgcctgt
gctgccaaaggcgtgctgctcagtgactggagggagggcatatgcgaaaaacctacaatt
acctgtcccaagtcgatgacctatcaataccatatcagcacctgccagcccacctgccgg
tctctgagtgaggaagatgtcacctgccatgtcaacttcatccctgtggatggctgcacc
tgccccaaaggcaccttcttggatgattcgggcaaatgtgtacaggccactagctgtcct
tgctattacaagggatccccagttcccaatggcgagtctgtgcatgacaacggggccatt
tgcacctgcacccaaggagcactaacttgtattggaggtcctgtcctgactccagtgtgt
gatgcccccatgatctattttgactgtcgtaatgccacacctggtgacactggagctgga
tgtcagaagagctgtcacaccctagatatgacctgctacagctccgagtgtgtgcctggc
tgtgtgtgcccgaatgggctggtggcagatggcaatggaagctgtgttgttgctgaggac
tgcccttgtgtgcacaatgaggccacctacaggcctggggagaccatccaagtgggctgc
aacaactgcacctgtgagaacaggatgtggcagtgcacagacaagccttgcctggccacc
tgtgctgtgtacggggatgggcactatatcacttttgatgggcagcgctacagtttcagt
ggggactgcgagtacacactgctgcaggacaactgtggtgggaacggcagctcccaggat
gcctttcgtgttgtcactgagaacattccctgtggtactacagggactacgtgctcaaag
ggaatcaagatcttcctggggagctatgagctgaaattgagtgacagcaagatggaggtg
gtccagaagggtgtggggcaggagcccccctacttcgtccatcagatgggcaactacctg
gtggtggaaaccgacattggcctggtgcttttgtgggacaagaagaccagcatctttctc
agactcagccctgagttcaagggcaaggtctgtggcctgtgtgggaactttgatgacaat
gccatcaatgacttcaccacacgcagccagtctgtggttagtgacatgctggagtttgga
aatagctggaagttgtctccgtcctgcccggatgcctcagtgtccaaggatccctgcact
gccaacccttaccgcaagtcctgggcccaaaagcaatgcagcatcatcaacagcgcaacc
ttctctgcctgccatgctcatgtggaaccggccaagtactatgaagcctgtgtgaatgac
gcctgtgcctgtgactcagggggtgactgcgagtgcttctgcactgctgtggctgcctat
gcccaggcctgccacgaagtgggagtgtgtgtgtcctggaggactccagacatctgtcca
ctgttctgtgactactacaacccagagggtcagtgtgagtggcactaccagccgtgtggg
gccccctgcatgcgtacctgccagaaccctactggacagtgcctacaagatctccgtggc
ctggaaggctgctaccccaagtgcccaccaacagcccccatctttgatgagggcactatg
cagtgtgtatccaactgtacagtcagcccctcaccctgccgtgtcaatggaaagttgtac
cgaccaggtacaccgataccttcagatgaaaactgttattcctgtgtttgtacggagagt
ggtgtgaactgtacccatgatgctggtgcctgtgtttgtacctacaatgggcaacggtac
catcctggggacaccatctaccacacgacagatggcatgggaggttgtatctctgcacac
tgcagggacaatggcaccattgagaggatcgttgatacctgcagttccaccagcccccca
ccccccaccactttctccttctccacaacgctggtcatgacctcaatgcaaccctccagc
acacattccagccctaccccgagcgtagtgtacccggggtccccaagcaaggccgtgttg
acagccagcagcgtatcgtctgtgaagacccctgaaacaacctctgtcttgactacatct
acttcagcctccaccttaaccatgccagcttgccaagaggagtgcctctggtctccctgg
atggatatcagccgtcctggacgtggcattgacagtggtgactttgacactctggagaac
ctccatgcccatggctaccagatctgcccagtgccaaaagcagtggagtgccgtgctgag
gataaccctggggtgcctttccatgcactacagcagcatgtggagtgtagcacaactgta
gggctgatctgttacaacagtgaccaggtgtcagggctctgtgacaactaccagatcaaa
atccaatgctgtacccccatcaactgtccaacctccactggtcctacccagaccacccat
ttgatagtctccaggacaagtacgatggaggacacaacctcctcagtccctgtcacctca
actgagcacacatatagcacagttgcctcaagtccttctacccataccccaggtccttct
ccctcttcctccgtaccttcttcatcagctccagctcgatcgactcctactccagtcagt
tctaccactgttaaaacaactctgcccaccacaagcccaatgccagagccaacttcagcc
acatcgtctgtgtccatctcaaccttagggtccaccctagcctcccctgagataactcat
gggtgcagaaaggagctttgcaattggactgattggatagatggcagctaccctgagcct
ggcagaagcagtggtgattttgacacctttgtaaacctgagagccaaagggtacaagttc
tgtgagaagccatggaatgttgagtgcagggctcagttctttcccaacacaccactgcaa
gagctgggacaggatgtgacctgtagccgagaagtgggtttgatctgtttgaacaagaac
cagctgccacccatttgctacaactatgagatccggatagaatgctgcaccatagtaaac
atctgttccacaacttcagctaccacacagcccacctcacatggagtcagcataaaaaca
aagacgaactggatcacaaacacatattccttttccaccgagaataccagtggtcactca
acagtcataaacaccaagacctgggtcacaggtagtacacacacaacccctcaaccagga
acaacccactgccagccacagtgcaactggaccaagtggcttgacactgacttcccagtt
cctggtccacatggaggggacctggaaacctatggcaacatcaagaagagcggagagaga
ctctgtccttggccagaggagatcacacggttggaatgtagggctaaggactaccctgag
agagcgatggaggatctgggtcaggtggtgcagtgtgaccccagcgtgggcctggtgtgc
aagaacagcgaccagggacccacctttgggatgtgcctcaactatgaggtgcgactgctt
tgctgtcacgttcccgaagactgcctcaccaccaaacgtacaactctttccagcacccaa
agtacgactgtcaccagctcaacacctggcactacttccatgccccaaactatgacaacc
attgtacagacagacagtaccacctccacatctcaaacaagctcacccattacagggaga
gccagcaccatccacacaactcaaaccacctcaacatcaacaggagaagcctggaccagc
tctgtgcagatagccagcactacctccacaacccacaccagctcaccaaatacaggaaga
gtcagcaccacccacagaacccacagcagctcaccacctacaggaggaaccagccccacc
cacagaactcacaccagctcaccacctacaggaggaaccagccccacctccacaacccac
atcagctcaccacctacaggaggaaccagccccacctccacaacccacaccagctcacca
aatacaggaagggtcaacaccacccacacaacccacaccagctcaccacccataggagaa
aacagtaccacctccacatctcaaacaagctcacccattacagggagagccagcaccatc
cacacaactcaaaccacctcaacatcaacaggagaagcctggaccagctctgtgcagata
gccagcaccacctccacaacccacaccagctcaccaaatacaggaagagtcagcaccacc
cacagaacccacaccagctcaccacccataggaggaaccagccccactcccacaacccac
accagctcaccacctacaggaggaaccagccccacctccacaacccacaccagctcacca
cccataggaggaaccagccccacttccacaacccacaccagctcaccacctacaggagga
accagccccacctccacaacccacaccagctcaccacctacaggaggaaccagccccacc
cacagaactcacaccagctcaccacctacaggaggaaccagccccacctccacaacccac
accagctcaccacctacaggaggaaccagccccacctccagaacccacaccagctcacca
cctacaggaggaaccagccccacctccacaacccacaccagctcaccacctacaggagga
accagccccacttccacaacccacaccagctcaccacctacaggaggaaccagccccacc
cacagaactcacaccagctcaccacctacaggaggaaccagccccacctccacaacccac
accagctcaccaaatacaggaagggtcaacaccacccacacaacccacaccagctcacca
cccataggagaaagcagcaccatttctaccacggatatcagaaccagctctacgcagatg
gcccacacaacattcgtggggaaaaccagcacgatctctggtcctggaaccagcaccacc
tccattcctaccagcaccacgggttccagctctcattttgaggtgactcgttccccagtg
acggcccactgccagccacagtgcaactggaccaagtggcttgacactgacttcccagtt
cctggtccacatggaggggacctggaaacctatggcaacatcaagaagagcggagagaga
ctctgtccttggccagaggagatcacacggttggaatgcagggctaaggactaccctgag
agagcgatggaggatctgggtcaggtggtgcagtgtgaccccagagtgggcctggtgtgc
aagaacagcgaccagggacccacctttgggatgtgcctcaactatgaggtgcgactgctt
tgctgtcacattcctgaagactgcctcaggaccgaccggactcctgtgacatcccacaag
acctcatttccagttgtgtcatcatcatctgtgtccacatcctcatctaccagtcctaga
gttcactctaccacccgttgtttctgcaccatgtcaggccaattataccctttgggaacc
atcatctacaaccagacagaccttgacggccactgttactatgcgatgtgcagccatgat
tgtcaggtggtcaaaggggttagtcaggactgcccctccaccatgccaccccgtacacca
actctatccacatctaccgccccacctgtcactgagcgggattggtgcaatgtgtttcct
ccaagactgaaaggggagacctggcccatgcctaattgttcccaagccacatgtgagggc
aacaatgttgtctctttgagcccacgccagtgtccagaggtgaaggagccatcttgtgcc
aatggctacccacctctgaaggtggatgaccaggacggttgctgccagcactaccagtgc
cagtgtgtttgcagcggctggggtgacccccactacatcacatttgacggcacctactac
acttttctggacaattgcacatacgtgctggtgcagcagattgtgcctgtgtttggagac
ttccgtgtgctcattgacaactactactgtgacctgggagacagtgtttcctgcccacag
tccatcattgtcgagtaccaccaggaccgtgtggtgctgacccgcaggccggttcacggg
gtcatgaccaaccagatcatcttcaacaacaaggtcgtgagtcctggcttccagcagaat
ggcattatcatctcccgtgtgggtatcaagatgtatgtcaccatccaagagattggtgtc
caggtcatgttttcaggcctcatcttctcagttgaggtgcccttcaacttgtttgccaac
aacacggagggccaatgcggcacttgtaccaatgacaaaaaggatgaatgccgcctgcct
ggaggttccatagcctcctcttgttctgagatgtccctccactggaaggtgcccaaccag
ccttcctgccaagggcctccaccaacaccaacttcaatggtacccaggtctacacctact
ccgtgctcaccatcgccactctgtcagctcatcctaagcgacgtcttcaagctctgccat
gacatcatccccccgctgcagttctatgaaggctgcttatttgactactgccacatgttg
gacttggaggtggtgtgctcaggcctggagctctatgcatcactatgtgcagcccaaggc
gtgtgcatcccctggagaagccataccaacaacacctgtccattcacgtgccctgaaaac
caagtataccagccttgtggtccttccaaccctcactactgctacaggaatgatgatatc
agcctaagcttggccattcaaaaggctggtcctaagtcagagggctgcttctgtccagat
gacatgacacttttcagttctaacgactcaatctgcgtgccttcctgccaatggtgtctg
gggcctcatggggaacctgtggagccgggccacaccatcagcatcaactgccaggactgc
atctgtaaggagggcacgctgacctgccaagagaagttatgcccccagcccacctgtcca
gaacccggctttgtgccggtgtctgtagccctggaggctggccagtgttgttcccagttc
agctgtgtctgcaactccagccactgccctcctcctttgcactgcccggagagttctagc
ctgatagtcacatatgaggagggaacttgctgcccaagccagaactgcagcagtcagaag
ggctgtgacgtcaacgggactctgtaccagcctggtgacgtggtctcctccagcctatgt
gaaagatgcctgtgtgaagtttccagcaatgccttttccgatggctttgtagtcaactgt
gagattgagctctgtaacacccaatgtcctaagggctttgagtaccagacgactccaggg
cactgctgtggccactgcataccgaagacctgcccctttaaaaacagcaataactccact
tccctctacaagcctggtgagttctggccagaacctgggaacccgtgtgtgactcataag
tgtgagaaattccaagatgtactcacggtggtgacaatgaagatagagtgccccaagatc
aactgtccacaagaccaggctcagctgagagaagacggatgctgctatgactgtctcgta
ccccagcagaaatgtacagtgcaccaaagacagcagatcatccgtcagcaaaactgcagc
tctgagggcccagtgagcctctcctactgccagggcaattgtggggacagcacctccatg
tactctctggaggccaacacggtggaacacacgtgtgagtgttgccaggagctgcagacc
tcgcagaggagtgtgactctgcactgtgatgacggctccagtcggaccttcagctacacc
caggttgagaagtgtggctgcctgggccagcggtgccatgctccaggtgacacaagccac
tcagagtcctcagaacaagagttcaagtccaaggaaagtgaggaacctggccagcagtca
gcatccagggtcagcgaggacacccttgggcctttccagtaa

DBGET integrated database retrieval system