KEGG   Rattus norvegicus (rat): 682902Help
Entry
682902            CDS       T01003                                 

Gene name
Taf12
Definition
(RefSeq) TATA-box binding protein associated factor 12
  KO
K03126  transcription initiation factor TFIID subunit 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    682902 (Taf12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    682902 (Taf12)
   03036 Chromosome and associated proteins [BR:rno03036]
    682902 (Taf12)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     682902 (Taf12)
   Coactivators
    SAGA/TFTC/STAGA complex
     682902 (Taf12)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     682902 (Taf12)
    STAGA complex
     682902 (Taf12)
    TFTC complex
     682902 (Taf12)
    SAGA complex
     682902 (Taf12)
    SLIK complex
     682902 (Taf12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIID_20kDa CBFD_NFYB_HMF Histone TFIID-31kDa CENP-T_C TAF4
Motif
Other DBs
NCBI-GeneID: 682902
NCBI-ProteinID: NP_001108508
RGD: 1592841
Ensembl: ENSRNOG00000048288
UniProt: B0BMY3
Position
5q36
AA seq 161 aa AA seqDB search
MNQFGPSALINLSSFSSIKPEPASTPPQGSMANSTTVGKMPGTPGTGGRLSPENNQVLTK
KKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHL
ERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtttggcccctcagcgctaatcaacctctccagcttctcctctataaaacca
gagccagccagcaccccaccacaaggctccatggccaatagcaccaccgtgggaaagatg
ccgggcactcctggcacaggtggtcgtctcagccctgaaaacaaccaggtattgaccaag
aagaagttacaagacctagtaagagaagtggatcctaacgagcagctggatgaagatgtg
gaagagatgctgctgcagatcgctgatgattttatcgagagtgtggtgacagctgcctgc
cagctcgctcggcaccgcaagtccagcaccctggaggtgaaagatgtccagctgcatcta
gagcgccaatggaacatgtggatcccaggatttggctctgaggagatccggccctacaaa
aaagcttgtaccacagaagctcacaaacagagaatggcgttgatccggaaaacaaccaag
aaatag

DBGET integrated database retrieval system