KEGG   Rattus norvegicus (rat): 682908Help
Entry
682908            CDS       T01003                                 

Gene name
Rcc1
Definition
(RefSeq) regulator of chromosome condensation 1
  KO
K11493  regulator of chromosome condensation
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    682908 (Rcc1)
   03036 Chromosome and associated proteins [BR:rno03036]
    682908 (Rcc1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     682908 (Rcc1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    682908 (Rcc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RCC1 RCC1_2 Peptidase_C25_C
Motif
Other DBs
NCBI-GeneID: 682908
NCBI-ProteinID: NP_001121661
RGD: 1592835
Ensembl: ENSRNOG00000050106
UniProt: B1H227
Position
5q36
AA seq 421 aa AA seqDB search
MPPKRIAKRRSPPEDAIPKSKKVKVSHRSHNTEPGLVLTLGQGDVGQLGLGESVLERKKP
ALVPLLQDVVQAEAGGMHTVCLSQSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEK
VVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDTQVVKVASG
NDHLVMLTTDGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPRCVLLKSRGTRGRV
RFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTGSCFIPQNLTSFKNSTKSWVGFS
GGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPVVSSVACGASVGYAV
SKDGRVFAWGMGTNYQLGTGQEDDAWSPVEMTGKQLENREVLTVSSGGQHTVLLVKDKTQ
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccacccaagcgcatagctaagagaaggtcacccccagaagatgctatccccaaaagc
aagaaggtgaaagtctcacacaggtcccacaacacagaaccaggcttggtgctgacattg
ggccagggcgacgtgggccagctggggctgggtgagagtgtgctggagaggaagaagccg
gccttggtaccccttctacaggatgttgtgcaggccgaggccgggggcatgcacactgtg
tgtctgagccaaagtggccaggtctactcctttggctgcaatgacgagggtgccctggga
agggacacctcagtcgagggctccgagatggtccccgggaaagtggaactacaagagaaa
gtggtgcaagtgtcagcgggagacagtcacacagcagctctcactgaagacggccgagtc
ttcctctggggctctttccgggacaataatggtgtgatcgggttgttggagcccatgaag
aagagcatggtgcctgtgcaggtgcagctggacacgcaggtggtaaaggtagcctcgggg
aacgaccacttggtgatgctcacaactgatggagatctctacaccttgggctgtggggag
caaggtcagctgggccgtgtgcctgagttatttgccaaccgaggtggccgtcagggcctt
gagcgactcctagtccccaggtgtgtgctgctgaagtcccggggaacgcggggccgcgtg
cggttccaggatgccttctgtggcgcctatttcaccttcgccatctcccgtgagggccat
gtgtatggctttggcctctccaactatcaccagctcggaactccaggcactgggtcttgc
ttcattcctcaaaacttgacatccttcaagaattccaccaagtcctgggtgggcttctct
ggtggccagcatcatacagtctgcatggattcagaaggaaaagcatacagcctgggccgg
gctgagtacgggcggctgggccttggggagggtgctgaggagaagagcatacccaccctc
atttcccggctaccggtggtctcctcagtggcctgtggggcttcagtggggtacgctgtg
tccaaggatggtcgtgtttttgcctggggcatgggcaccaactaccaactgggcaccggg
caggaggacgatgcctggagcccggtggagatgactggcaaacagctggagaaccgtgag
gtgttaacggtgtccagtgggggccagcacacagtcttactagttaaggacaagacccaa
agctga

DBGET integrated database retrieval system