KEGG   Rattus norvegicus (rat): 683163
Entry
683163            CDS       T01003                                 

Gene name
Tnfsf8, Tnlg3a
Definition
(RefSeq) tumor necrosis factor superfamily member 8
  KO
K05471  tumor necrosis factor ligand superfamily member 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    683163 (Tnfsf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    683163 (Tnfsf8)
   04090 CD molecules [BR:rno04090]
    683163 (Tnfsf8)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Tumor necrosis fators
   683163 (Tnfsf8)
CD molecules [BR:rno04090]
 Proteins
  683163 (Tnfsf8)
SSDB
Motif
Pfam: TNF SusF_SusE
Other DBs
NCBI-GeneID: 683163
NCBI-ProteinID: NP_001305962
RGD: 1590403
Ensembl: ENSRNOG00000048321
UniProt: M0R3V3
Position
5q24
AA seq 237 aa
MEPGLQQARSRGAPSPDPAMQVPPGSADSLWRSTRPWRTRSYFYLSTIALVCLVVALAII
LVLVVQKKDSTPKTTESVPLKGGNCSEDLLCTLKRTPSKKSWAYLQVSKHLNSAKLSWNQ
DGTIHGLVYQDGNLVVQFPGWYFIICQLQFLVQCSNHSMDLTLQLVINSKIKKQALVTVC
ESGVQGKNIYHNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD
NT seq 714 nt   +upstreamnt  +downstreamnt
atggagccagggctgcaacaagcacgcagccgtggggccccttcccctgacccagccatg
caggtgccgcccggctcggcagacagcctctggagaagcacgaggccctggagaacccgc
agctacttctacctcagcaccatcgcactggtgtgccttgtcgtggcactggcaatcatt
ctggtcctggtagtccagaaaaaggactccactccaaaaacaactgagtcggtccccctt
aaaggaggaaattgctcagaggacctcttatgtaccctgaaaaggactccatccaagaag
tcatgggcctacctccaagtgtcgaaacatctcaacagtgccaaactatcatggaaccaa
gacggtaccatccacggactcgtataccaggatgggaacctggtggtccaattcccaggc
tggtacttcatcatttgtcaactgcaatttctcgtgcagtgctcaaatcattccatggac
ctgacactgcagctcgtcatcaattccaaaatcaaaaagcaggcactggtaacagtgtgt
gagtctggagttcaaggcaagaacatctaccataatctctctcagttcttgctgcattac
ctacaggtcaactctaccatatctgtccgggtggataatttccagtatgtggatacaaac
actttccctcttgataacgtgctgtccgtcttcctatatagtagctcagactga

DBGET integrated database retrieval system