KEGG   Rattus norvegicus (rat): 683381Help
Entry
683381            CDS       T01003                                 

Gene name
Sin3b
Definition
(RefSeq) SIN3 transcription regulator family member B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PAH
Motif
Other DBs
NCBI-GeneID: 683381
NCBI-ProteinID: NP_001108510
RGD: 1587989
Ensembl: ENSRNOG00000048622
UniProt: B0BNJ0
Position
16p14
AA seq 292 aa AA seqDB search
MAHAGGGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLE
IMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSNQ
DNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLE
ILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGS
CEMNSAQKNEEKSLEHKKRSRPSLLRPVSAPAKVGLQLKCAVVWFGYCTAEE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgcaggcggtggaggctccgcgggccggggattcggtggctcccgctggggt
cgttcgggctctggggggcacgagaagctgccagtgcacgtggaggatgctctcacctac
ctcgaccaggtgaagatccgctttggcagtgaccctgccacctacaacggcttcctggag
atcatgaaggagttcaaaagccagagcattgacacccccggcgtgattaggcgtgtgtcc
cagctcttccatgagcaccctgacctcatcgtggggtttaatgctttccttccgcttgga
taccgcatagacattcccaagaacggcaagttgaacatccagtcacctctgagcaaccag
gacaactctcatagccatggtgactgtggggaggacttcaagcagatgtcctacaaggag
gacagaggccaggtgcccctggagtccgactctgtggagttcaacaatgctatcagctat
gtgaacaagatcaagacccgctttctggaccaccctgagatctacaggtccttcctggag
atcctacacacctaccagaaggagcagctgcacactaagggtcgtccattccgtggcatg
tctgaggaggaagtcttcacagaggtggccaatctcttccgtggtcaggaggacctactg
tcagagttcggacagttcctgcctgaggcaaagcggtccctgtttacaggcaatgggtcg
tgcgagatgaacagcgcacagaagaatgaggagaagagtctggaacacaagaagcgctcg
cggccttcactgctgcgccctgtgtctgcgccagccaaggtggggctgcagttgaaatgt
gcagttgtgtggtttggttactgcacagctgaggagtga

DBGET integrated database retrieval system