KEGG   Rattus norvegicus (rat): 683404Help
Entry
683404            CDS       T01003                                 

Definition
(RefSeq) similar to Retinitis pigmentosa 1-like 1 protein (Retinitis pigmentosa 1-like protein 1)
  KO
K19538  retinitis pigmentosa 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    683404
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     683404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DCX
Motif
Other DBs
NCBI-GeneID: 683404
NCBI-ProteinID: XP_008767499
RGD: 1586886
Ensembl: ENSRNOG00000046326
UniProt: M0R410
Position
15p12
AA seq 1860 aa AA seqDB search
MNSTPGDTRDAPAPSHPAPSHRQCLLPSVAHTPSVTEVTPAKKITFLKRGDPQFAGVRLA
VHQRTFKTFSALMDELSQRMPLSFGVRSVTTPRGLHGLSALEQLQDGGCYLCSDRKPPKT
PRESGRLQRKSPPAGRSQVSQGGHEAPETSSYSWKNPMAPRRLTLVKNGYPGCQQTVVLS
HKNTRNLAGFLSKASELLRFPVKQVYTTHGKKVDSLQTLLDGPSLLVCAGNEAFRRLEME
NDRGNRTRMVSGVTARSERGCWGPNAKQSVIHSRGRSGGKLRQFSLMSERSGLSDHPASG
HQAWAGPALDRCPQDTPAPPGSLVAADDVEKKVCMNEDGSLSVEMKVRFQLLGEDTLRWS
QRVGHASVFTAATGEDRDLREADRLCCRQEGYPWGVLEPGAQGLGPHDGGCQGAFDVGQQ
SRPSYDIWRNPLTAPEGTGPTPRRRWGLAKLSRCWREGTNDRKGHDKANASPVSTPRHPG
SVQPGSCCLWTPEVETGSDTLRPVSSASSRSETDLESGEDPCLEDTGPCGLRLQTQSIDR
ALSDTSASAESREESCEGGGQLHRGSSQARVMASQGQATRGDNPCISTQRHLSLNHTGLQ
TKKDRQSASCQEVRGDPVLRLPLVPRHSGSRDTQRDALPAPACAPAQRRQRKQKRPAGVV
CLPSVSIPHQVAQKGHARQCHCCRDTQSSGDTALQMTMPMEREQACPGSPAPQFPSNSPR
AGNQAPECLRPPFSSSLDFQEPQATSIAMSDSDCMSSFCHPSTRSAEPAEDSKCQAPSST
PTPIHRGEVGYLWDKAGSTPEPFSSSVLLNRWPEADLRTYQNFGCLQVAPTSTLATPSSQ
TQASISEACLGDNSSCPTPPQDQICSRREPASSNSTHSDHGRADGYTGPRRTLPGMPLGI
RGSLEEQEGDGGVTPSALPYTSPDAVVREWLGNIPEKPALMTYEVADETIEVPSEGPEGP
KEDLGDGCSLKVFGELTQARQQMLEGVTDEHPEPAGVPAGPGSVCCKLGGDMHSDATSVE
RLKAPAEAGTGEGTTVERGVSLCALPTRVSASTQIMKALLGSKPGRPSSLPEVSSTVAQR
LSCSAGALIACLAKLHFFDEDLGPLDGKRRLEESPKYQEMLNISQTLWPGSELGQGQLDF
SLRRLTSHQALLGTEDFTPTSSSGVDVSSGSGGSGEGSVPCVMDSTLASKKIDLPLKIPS
QRPDSRNQGYPEIVSPSTVSSGSQMRACTTSGEEAGKGGRKQTWGSAPEQSVENKVPEGD
AQLEETEGRARERLQENSVLGEGLPEEGTRVCSQGMLAANSRDGAGSPEDTRVPNDEVGT
DGGLWPLDGREDPTESPCHFEESNSRVSERQSAHVPELGLDVRGGKQACVKASSETRETN
TSIAHRGTLDPDPIWVSKLLKKIEKAFMAHLTDATAELRARWNLHDNNLLDQMVTELEQD
VGQRLQASTVREVRKIQSRAGRMFPEPPREALRGQSSLQTEQRRRRLQGLRNLSAFPGQG
PLSFTLEDGATLGTALGTRSGAGLVEDEFCPCEICLKKKRTPRFPKDSTTVSGAPVRKAF
DLQQILQSKKDGSSNREAMEVSPQKTGMMLSQEDPRTVQGADEKQELRLAQGLGVAEGEE
GEGKQRMRAEEDTEFSKAEGDGCHAPKEDATTKEDGKICIGTAQDGQQLEGTEIGKEETL
HQSFRDGDTSEAPARQGGHSVESQEASREGQPEVEGRNPDEKEESSWVSSEESQGRVGSE
NNSLDQEGRLQDHHQRPGPQSHHAARSSRAMSLDNCSQVSQKGSDRDFPSGDLKYNKAKN
SGVLPAERKVPMMYPESSSSEQEAPSSPRPPKQEKGEDGRSACTQVGGRVDGFGQDDLDF
NT seq 5583 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaccccaggagacacgagggatgctcctgccccaagccaccctgcaccaagc
caccggcagtgtctcctgccctctgtggctcacactccctctgttactgaagtgacacca
gccaagaagataaccttcctcaagcgaggagacccccagtttgctggggttcgcctggct
gttcaccagcgcactttcaagaccttcagcgccctaatggatgagctgtctcagcgcatg
cctctttcctttggggtgcgttctgtcaccacaccccggggattgcatggcctcagtgcc
ctggagcagttgcaagatgggggttgctacctctgctctgatagaaagccccctaaaact
cccagagagtcaggccggcttcaaaggaaaagcccccctgctgggcggtcacaggtttcc
caaggtgggcacgaagctccagaaacatcctcctattcctggaaaaatcctatggcccca
agaaggttgaccctggtaaagaatggatatcctggatgccagcagacagtggttctcagt
cacaagaataccaggaacctggcaggcttcctcagcaaagcctctgagcttctgcgcttt
cccgtcaagcaggtgtacacgacccatgggaagaaggtggactctctgcagacactcctg
gacggcccctccctgctggtatgtgctgggaatgaggccttcagacgtctggagatggaa
aatgacagagggaacaggaccagaatggtatctggtgtgactgcaaggagtgaacgtggc
tgctggggaccgaacgccaagcagagtgtcatacactcaaggggcaggtctggcggcaag
ctgcggcagttttccttgatgtcagagaggtctggtctcagtgaccatccagcatccggt
catcaagcctgggcaggtcctgctttggacaggtgccctcaggacacgcctgccccacct
ggttccttggtggctgctgatgatgtggagaagaaggtctgcatgaatgaagacggcagt
ctgtctgtggagatgaaagtccgcttccagttactgggggaggacaccctgaggtggtcc
cagagggtggggcatgccagtgtcttcacagcagccactggagaggatcgggacctgagg
gaggctgacaggctctgttgcagacaggagggctacccttggggcgtcttagaacctggg
gcacagggactgggtccccatgatggaggatgccagggagcctttgatgtgggccagcag
tcacggcccagctatgacatatggaggaatcccctgacagcccctgagggcacagggcca
actcctcgtaggagatggggtctggctaagctctctagatgctggagagagggaaccaat
gataggaaaggacatgacaaggctaatgccagcccagtctcaactcccaggcaccctgga
agtgtccagccaggctcctgttgtctttggactcctgaagttgaaacaggcagtgacacc
ttgcgtccagtctcctcagcttcttcccggagtgagactgacctggaatctggtgaggac
ccctgcctagaggacaccggaccctgtggcttgagacttcagacccaaagtatagacagg
gccctttctgatacatcagccagtgccgagtctcgtgaggagtcttgtgagggtggtggt
cagctccacagaggctcaagccaggcaagggtcatggcttcccaggggcaagccactaga
ggtgataacccctgtatttccacccagaggcacttatctttgaaccacacgggtcttcag
acaaagaaggacagacagagcgccagctgccaggaggtcaggggtgatcctgtactgaga
ctgcccctggttccacgccattctggctctcgggacacacagagagatgccctcccagct
cctgcctgtgccccggcccagcggaggcagagaaagcagaagaggccagctggtgttgtg
tgcttgcctagtgtctctatccctcaccaagtagcccagaaaggccatgccaggcagtgt
cactgttgcagggacactcagtcctcaggggacacagccttgcaaatgacaatgcctatg
gaaagagagcaagcctgcccaggaagcccggcaccacaatttccttcaaactcacccagg
gctgggaatcaggcccccgagtgtctgagacccccattctccagctctcttgattttcag
gaaccacaagccaccagcatcgccatgagtgactcagactgtatgtccagcttttgtcat
cccagcactcgctctgcagagccagcagaggatagcaagtgccaggctccctcatcaact
cctacacctatccacagaggagaggttggttatctgtgggacaaggcagggagcacccct
gagcctttctcatcctctgtgctactgaacagatggcctgaggcagatctaagaacctac
caaaatttcggctgcttacaggttgcaccgacttctacccttgcaacccctagcagtcag
acgcaggcctccatctctgaggcctgcttgggggacaatagttcctgcccaactccaccc
caggatcaaatatgttctagaagggagcctgcaagcagcaatagtacccacagtgaccac
ggtcgagccgatggctacactgggcccaggaggactcttccggggatgccccttggcatc
aggggaagccttgaggaacaggaaggggatggtggtgtgacgcccagtgctctgccttac
acctctccagatgctgtggttcgtgagtggctaggcaacatcccagaaaagccagcactc
atgacatatgaggtggcggatgagaccatagaggtgcccagtgagggcccagaaggtccc
aaggaggacctgggtgatggctgttctttgaaagtctttggggaactgactcaggccaga
cagcagatgctagaaggggttactgatgagcacccagagccagcaggagtccctgcagga
cctggttctgtgtgctgcaaactgggaggtgatatgcattcagatgcaacatcagttgaa
aggctcaaggctcctgcagaagctggaacaggagaagggaccacagtggagcgtggtgtg
agcctgtgtgcactccccaccagggtctcagcctctacacagatcatgaaggccctgctg
ggctccaagccaggccggcccagcagtctaccagaagtctctagcacagtagcccagaga
ctcagctgctcggctggggccctcattgcctgccttgccaagctccatttttttgatgag
gatctgggacctctggatggcaaacggaggcttgaagagtcccctaagtaccaggagatg
ctcaacatctcccagacgctgtggcctggaagtgagcttgggcagggccagctggatttc
agcctcaggaggctcacttcacaccaggctctgctggggactgaggacttcactcccacc
tcctcctctggcgtggacgtgagcagtggctctggaggctcaggtgagggcagcgtgccc
tgtgtcatggatagtaccctggcttccaagaagatagatttgcctttgaaaatcccctct
caaaggcctgattccaggaaccaggggtacccagagatagtgagtccttccacagtctca
tccggctcccagatgagggcttgtaccaccagcggggaagaggcaggcaaaggaggcagg
aagcagacgtggggcagtgccccagaacagtcagtcgaaaacaaggtgccggaaggggat
gcacagttagaagaaacagaagggagagcaagagaaaggctacaggaaaacagtgtcctc
ggagaagggcttccagaagaagggactagggtctgcagccagggaatgcttgcagctaac
tctcgagatggagcaggttctccagaagacacaagagtgccaaacgatgaagtaggaact
gatggaggactgtggcccctagatgggagagaggatcccacagagtccccttgccatttc
gaggagagcaactcaagggttagtgagcgtcaaagtgctcacgtgccggagctgggattg
gacgtaaggggcggcaagcaagcctgcgtcaaggccagctcagaaaccagggagacgaac
acatccatagcccacaggggaactctggaccctgacccaatctgggtgtccaagctgctg
aagaagatagagaaagcctttatggctcacctaactgatgccacagctgaactccgagcc
cgatggaatctccatgacaacaacctgctggaccagatggtaacagagctggagcaggat
gtgggccagcggctgcaggcaagcactgtcagggaagtcaggaagatccagagccgggca
gggaggatgtttccagagcccccccgggaagccctcagaggccagtcttctctacaaaca
gagcaacgtcggcgtcgcctccagggcctgcgtaacctgtcggccttccctggccagggc
cccctctccttcactctggaggatggggccactctgggcacagccttagggaccaggtca
ggtgcagggcttgtggaggatgagttctgtccctgtgaaatctgtctgaagaagaagagg
acccctagattcccaaaggatagcacaacagtctctggtgcacccgtcagaaaggccttt
gacctacagcaaattctacagagcaaaaaggacggaagtagcaatagagaggccatggag
gtgtcccctcagaagacagggatgatgttgtctcaagaggaccccagaactgtccaggga
gctgatgagaagcaagaactgaggttggcacaagggcttggggtagctgagggagaggag
ggggaagggaagcagaggatgagagcagaggaggatactgagttttcaaaagcagaagga
gatggttgccatgcaccaaaagaggatgcaaccaccaaggaagatgggaaaatctgcatc
ggcactgcccaagatggccagcagttagaggggactgagatcggaaaggaggaaaccctg
caccagagctttagagatggagacacttctgaggctccagcaagacagggaggccactcg
gtggagagtcaggaagcttccagagaagggcagcccgaggtagaaggcagaaatccagat
gaaaaggaagaaagctcttgggtaagctcagaagagagccagggaagggtgggttctgaa
aacaacagcctagaccaagaggggaggctccaggaccaccatcaaaggccaggcccccag
agccaccatgcagcacgctcctccagggcaatgtctctggacaactgctcacaggtgtct
cagaagggctcagacagagactttccaagtggagacctcaagtacaacaaagccaagaac
agtggggtcttgcctgcagagaggaaagtccccatgatgtatccagagagttcctcttct
gagcaagaagccccctccagcccgaggcctccaaagcaggaaaaaggggaagatggacgg
tcagcttgtacccaggttgggggtagggtagatggctttggccaggatgacttagatttc
tag

DBGET integrated database retrieval system