KEGG   Rattus norvegicus (rat): 683415
Entry
683415            CDS       T01003                                 

Gene name
Prss55
Definition
(RefSeq) protease, serine, 55
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 683415
NCBI-ProteinID: XP_008767522
RGD: 1586875
Ensembl: ENSRNOG00000047258
UniProt: M0RBY1
Position
15p12
AA seq 321 aa
MILPSILLLVVHTLEANVECGVRPLYDSRIGHSRIIGGQEAEVGEFPWQVSIQENDHHFC
GGSILSEWWILTVAHCFYSQELSPTELTVRVGTNDLTTSPMELQVTNIIRHKDFKRHSMD
NDIALLLLANPLTFNEQTVPICMPLQPTPPSWQECWVAGWGTTNSADKESMNMDLMKVPM
RITDWKECLQLFPSLTTNMLCASYGNESFDACQGDSGGPLVCNQESDGRWYQVGIISWGK
SCGQKGSPGIYTVLANYILWIEKITQIEGKPLDLNSQMVSVKKKTRKNNQTSKCPALNYP
QSWLLPCLLSFALLRALSNWE
NT seq 966 nt   +upstreamnt  +downstreamnt
atgatcctaccctccattctgctgcttgttgtccacactctagaagcaaatgttgaatgc
ggtgtgagacccctgtatgatagcagaattggacactccaggatcataggagggcaggag
gctgaggtgggtgaattcccatggcaggtgagcattcaggaaaatgaccatcatttctgc
ggcggctccattctcagtgagtggtggatactcaccgtggcccactgcttttattctcag
gagctttccccaacagaactcacagtcagagtgggaaccaatgacttaactacttcaccc
atggaactgcaggtcaccaacataattcggcacaaagactttaaacgacacagcatggac
aacgacatcgccttgctgctgctggccaatcccttaacgttcaatgagcagacagtgccc
atctgcatgcccctccagcccacccctcccagctggcaggaatgctgggtggcaggatgg
ggcacaaccaactcggctgacaaagaatccatgaacatggatctgatgaaggtgcccatg
cgcattacagattggaaggaatgcttacagttgtttccaagcctcaccacaaacatgctg
tgtgcttcatatggcaatgagagcttcgatgcctgccagggtgacagtgggggaccactt
gtctgcaaccaagagtctgacggcaggtggtaccaagtgggcatcatcagctggggcaaa
agctgtggacaaaaaggctccccagggatatacactgtcttggcaaactatatcctgtgg
attgagaaaatcacccagatagaggggaagcccttggatcttaatagtcagatggtctct
gtcaagaagaaaaccaggaagaacaaccaaacctccaaatgcccagccctgaactacccc
caaagctggctcctgccctgtcttctgtcctttgcactgcttagagctttgtccaactgg
gaataa

DBGET integrated database retrieval system